(data stored in ACNUC7421 zone)

EMBL: CP000478.PE429

CP000478.PE429       Location/Qualifiers
FT   CDS_pept        525404..526213
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sfum_0433"
FT                   /product="phosphoribosylformylglycinamidine synthase
FT                   subunit I"
FT                   /EC_number="6.3.5.3"
FT                   /note="TIGRFAM: phosphoribosylformylglycinamidine synthase
FT                   I; KEGG: sat:SYN_00522 phosphoribosylformylglycinamidine
FT                   synthase"
FT                   /db_xref="EnsemblGenomes-Gn:Sfum_0433"
FT                   /db_xref="EnsemblGenomes-Tr:ABK16133"
FT                   /db_xref="GOA:A0LFD1"
FT                   /db_xref="InterPro:IPR010075"
FT                   /db_xref="InterPro:IPR017926"
FT                   /db_xref="InterPro:IPR029062"
FT                   /db_xref="UniProtKB/TrEMBL:A0LFD1"
FT                   /protein_id="ABK16133.1"
FT                   /translation="MSRVKALVLTGFGLNCDLETAYALTIVGADVERVHLNSLAQREKR
FT                   LADYRIFVVGGGFSWGDDHGAGVIMGMRLKHRLGDDLQAFVASGGIVIGICNGFQVLVN
FT                   LGLLPGFEPGVLKREVALINNDCGNFRDQWVNLIGNAASPCVLTEGIEAIELPVRHGEG
FT                   KFFAETDVLERLERRQQVILRYAGADGKVAGGAFPANPNGSVADIAGICDPTGRVAGLM
FT                   PHPEAFNDWTNHPEWTRKRELARRSGTVAPREGEGLKLFRNAVNYFR"
     atgagccgcg tgaaagccct ggtgttgacg gggttcggtc tcaactgcga cctggagact        60
     gcctatgcct tgaccatcgt cggggcggac gtcgaaaggg tccacctcaa ttcgttggcg       120
     cagagggaga agcgcctggc cgattatcgc atctttgtcg tgggcggcgg gttttcgtgg       180
     ggcgacgatc acggggccgg cgtcatcatg ggcatgcggt tgaagcatcg actgggagac       240
     gatctgcagg cgttcgtcgc ctcgggcggc atcgtgatcg ggatctgcaa cggcttccag       300
     gtgctcgtga atctgggtct gctgcccggt ttcgagcccg gtgtgctcaa gcgcgaagtg       360
     gcgctcatca acaacgactg cgggaatttc cgggaccagt gggtgaactt gatcggcaat       420
     gcggcctctc cctgcgttct caccgaaggc atcgaggcga tcgagctccc ggtgcgtcac       480
     ggagagggca aattcttcgc tgaaacggat gtcctggaac ggctcgaacg acggcagcag       540
     gtgatcctgc gctacgccgg ggcggacggc aaggttgccg gcggcgcctt ccccgccaat       600
     cccaacgggt ccgtggcgga cattgcgggc atatgcgatc cgacgggcag agtcgccggg       660
     ttgatgcctc acccggaagc gttcaacgac tggacgaacc atcccgaatg gacgcgcaaa       720
     agagagctcg ccaggcggag cgggacggtc gcgccccggg aaggagaggg cctgaaactg       780
     ttccgcaacg cggtgaacta tttccgttga                                        810
//

If you have problems or comments...

PBIL Back to PBIL home page