(data stored in ACNUC7421 zone)

EMBL: CP000478.PE430

CP000478.PE430       Location/Qualifiers
FT   CDS_pept        526280..527131
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sfum_0434"
FT                   /product="phosphoribosylglycinamide formyltransferase"
FT                   /EC_number="2.1.2.2"
FT                   /note="TIGRFAM: phosphoribosylglycinamide
FT                   formyltransferase; PFAM: formyl transferase domain protein;
FT                   KEGG: ade:Adeh_1254 phosphoribosylglycinamide
FT                   formyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Sfum_0434"
FT                   /db_xref="EnsemblGenomes-Tr:ABK16134"
FT                   /db_xref="GOA:A0LFD2"
FT                   /db_xref="InterPro:IPR002376"
FT                   /db_xref="InterPro:IPR004607"
FT                   /db_xref="InterPro:IPR036477"
FT                   /db_xref="UniProtKB/TrEMBL:A0LFD2"
FT                   /protein_id="ABK16134.1"
FT                   /translation="MSESDSRLRIAVLVSGSGTNLQALIDRARDGRLAAEIVVVASDRP
FT                   GIRGLARAEAAGIPARVVDYRGFLKQDWTVLERKLPVDVDAVDRAQNILHHEDREERLK
FT                   RLVRLMSAEAEMIAAIEAYRPDYVCLAGFMRLVTPFFLHHFNRAGKLRVINIHPALLPA
FT                   FPGQHGYEDTFSYGCRWGGITIHFVDEGEDSGPIIAQAVYPILPEDDVEKVRQRGLQLE
FT                   YEMYAQVINWLAAGRVELVPAAGGRARTVIRDPEYSRIMESWVRKVLDAGPQDCRFSDP
FT                   SA"
     atgtccgaat ctgattccag gctgcgcatc gccgtcctcg tttcggggag cggcacgaat        60
     ctgcaggcgc tcatcgaccg ggcccgtgac ggcaggctgg cggccgaaat cgtggtcgtg       120
     gcatcggacc gtccggggat acggggactg gctcgagccg aggcggcggg catcccggcg       180
     cgcgtcgtcg actacagggg attcctgaaa caggactgga cggtgctcga gcgaaaactg       240
     ccggtggacg tggacgcagt ggaccgcgcg caaaacatcc tgcatcacga agaccgggag       300
     gagcggctca agaggctggt ccgcctgatg agcgccgagg cggaaatgat cgcggccatc       360
     gaggcctacc ggccggacta cgtttgcctg gcgggattca tgcgcctggt gacgcctttc       420
     ttcctccatc acttcaaccg ggcggggaaa ctgcgggtca tcaacattca ccccgccttg       480
     ttgcctgcgt ttcccggaca gcacggttac gaggacacct tctcctacgg ctgcaggtgg       540
     ggagggatca cgatccattt cgtggacgaa ggggaggatt ccggtccgat catcgctcaa       600
     gccgtttacc caatcctgcc ggaagatgat gtcgaaaagg tccggcaacg cggattgcag       660
     ctggagtatg aaatgtacgc ccaggtgatc aactggctgg ccgcgggccg ggtcgaactg       720
     gtccccgcgg cgggcggtcg agccaggacg gtgatccgcg atcccgaata ttcccgcatc       780
     atggaatcct gggtccgaaa ggtcttggac gcaggtccgc aagattgccg cttttccgac       840
     ccgagtgcct ga                                                           852
//

If you have problems or comments...

PBIL Back to PBIL home page