(data stored in ACNUC7421 zone)

EMBL: CP000478.PE435

CP000478.PE435       Location/Qualifiers
FT   CDS_pept        complement(530040..530939)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sfum_0439"
FT                   /product="RNAse Z"
FT                   /EC_number="3.1.26.11"
FT                   /note="PFAM: beta-lactamase domain protein; KEGG:
FT                   tde:TDE1951 ribonuclease Z"
FT                   /db_xref="EnsemblGenomes-Gn:Sfum_0439"
FT                   /db_xref="EnsemblGenomes-Tr:ABK16139"
FT                   /db_xref="GOA:A0LFD7"
FT                   /db_xref="InterPro:IPR001279"
FT                   /db_xref="InterPro:IPR013471"
FT                   /db_xref="InterPro:IPR036866"
FT                   /db_xref="UniProtKB/TrEMBL:A0LFD7"
FT                   /protein_id="ABK16139.1"
FT                   /translation="MMPMPGRYLASMAVRLDGRLYLFDAGEGTQLAWKTCRIGLRGLSV
FT                   VAVTHLHADHCLGIPGLMMLKAQLDDPEPLTVMGPPGIREFILENHRILDFHLNYPLEF
FT                   IEWSADAPDWKAYEDELLRIFWEPLEHTRFCLGYRVEELERPGRFHPDAADALDIPEGP
FT                   LRGRLQRGESVTLPSGTVVAAHQVSGPPRRGRHLAYVVDTRPTPAIQRLCQGADLAFIE
FT                   GMFLPEHAEQARAKGHLTVVEAARAARKAGARRAVLIHISPRYGEEDLDRLERAAREHF
FT                   QDAVVGRDLQVYSVPLPD"
     atgatgccca tgccgggtcg atacctcgca tccatggcgg tcaggctgga cggcaggctt        60
     tacctcttcg atgcgggcga aggaacgcag cttgcctgga aaacctgccg catcggtctg       120
     cgcggcctct cggtcgtggc cgtcactcac cttcacgccg atcactgcct cggcattccc       180
     ggcctgatga tgctcaaagc ccagctggac gatcccgagc cgctcaccgt catgggcccc       240
     cccggcatcc gcgagttcat cctcgagaat caccgcatcc tcgactttca tttgaattac       300
     ccgctcgaat tcatcgagtg gtcggccgac gcaccggatt ggaaagcgta cgaagacgaa       360
     ctgttgcgca tattctggga accgctggag cacacgcggt tttgcctggg gtaccgggtc       420
     gaggaactgg aacgcccggg gcggtttcac ccggatgcgg ccgacgcgct ggatatccct       480
     gaaggccccc tgcgcggcag gctccagcgg ggggagagcg tcaccctgcc ctcaggtacg       540
     gtcgtcgccg cgcaccaggt ctccggaccg ccgcgcaggg gcagacatct cgcctacgtg       600
     gtcgataccc gcccgactcc cgcaatccaa aggctctgcc agggtgcgga cctggcgttc       660
     atcgagggca tgttcctccc cgagcatgcc gaacaggcac gcgccaaggg tcacctgacc       720
     gtggtcgagg ccgcccgggc ggcccgcaaa gccggggctc ggcgggccgt tttgatccat       780
     atcagtcccc ggtacggcga ggaagacctc gatcgcctgg aacgcgcggc gcgtgagcac       840
     ttccaggatg ccgtcgtggg cagggacctc caggtctatt cggttcccct gccggattga       900
//

If you have problems or comments...

PBIL Back to PBIL home page