(data stored in ACNUC7421 zone)

EMBL: CP000478.PE437

CP000478.PE437       Location/Qualifiers
FT   CDS_pept        532102..532671
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sfum_0441"
FT                   /product="OsmC family protein"
FT                   /note="PFAM: OsmC family protein; KEGG: gsu:GSU2788
FT                   hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sfum_0441"
FT                   /db_xref="EnsemblGenomes-Tr:ABK16141"
FT                   /db_xref="InterPro:IPR003718"
FT                   /db_xref="InterPro:IPR015946"
FT                   /db_xref="InterPro:IPR036102"
FT                   /db_xref="UniProtKB/TrEMBL:A0LFD9"
FT                   /protein_id="ABK16141.1"
FT                   /translation="MSFQAAEQRDERTVNGVDVNRLFDTIDAVKAEPEIAKFRFRVKNK
FT                   WIGGGHNHTTITDFYGALKDHPHEKPFELDADEPEVLLGEDKGPNPVEYLLTALAGCLT
FT                   SSLVYHAAAKGIELKGVESRLEGDLDLRGFLGLSKDVPVGYREIRVYFTIDADLSEQEK
FT                   QELIREAQKYSPVFNTVSNSTRVTVQ"
     atgagcttcc aagcagctga acaaagagat gaacgtacgg tgaatggagt cgatgtaaac        60
     cgactcttcg atacgataga tgcggtcaag gctgaaccgg agatcgccaa attcaggttc       120
     cgcgtgaaga acaagtggat cggaggggga cacaatcaca cgacgatcac ggatttctac       180
     ggcgcattga aagaccatcc ccacgagaaa cccttcgaac tggacgcgga tgaacccgag       240
     gtgcttctcg gagaagacaa ggggcccaac ccggtcgaat accttctcac ggcccttgcg       300
     ggttgtctga cctcttccct ggtctatcac gcggcggcga aggggatcga gctgaaaggg       360
     gtggaatcgc gcctggaagg cgacctggac ctgcgggggt tcctgggtct gtcgaaagat       420
     gttcctgtcg gataccggga gatcagggtg tatttcacaa tcgatgccga cctgtcggag       480
     caggagaaac aggaactgat ccgggaggcg cagaagtatt cgccggtctt caacaccgtc       540
     tccaattcca ccagggtcac ggttcaataa                                        570
//

If you have problems or comments...

PBIL Back to PBIL home page