(data stored in ACNUC7421 zone)

EMBL: CP000478.PE439

CP000478.PE439       Location/Qualifiers
FT   CDS_pept        533619..534596
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sfum_0443"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: dps:DP3001 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sfum_0443"
FT                   /db_xref="EnsemblGenomes-Tr:ABK16143"
FT                   /db_xref="GOA:A0LFE1"
FT                   /db_xref="InterPro:IPR019020"
FT                   /db_xref="UniProtKB/TrEMBL:A0LFE1"
FT                   /protein_id="ABK16143.1"
FT                   /translation="MKTPAILLLFLAVLICGNAFMADLATSAAIETLAAAKVPKGPTSL
FT                   DDPVWQKAKPLDIPFAGKEKFAGKKANVITQAVYTDDEIFFLFKWKDATNSVTKGAWQF
FT                   DGEKWTHLKGDEDRISLLFEINRINNFATKGCAVTCHGAAGAAVKDFKFATASAGEKGD
FT                   LWHWKAARSDPYKSADDGWLTAAGEKTGRKDDAGGGGDARNETADKSKPQFMQDPSKKP
FT                   SAPGVLLAEDTVEITDHGKFKANDTLTYRMPKKPSGSRADIKAESRYADGGWTVMLSRK
FT                   LDTGNDDDVAFNTKKKYSFALALFDDSMDYDSYDSEALVLEFGR"
     atgaagactc cggcaatctt attgctcttc ctggctgttt taatctgcgg gaacgcattc        60
     atggcggatc tggccaccag cgcggctatc gagacgcttg cggccgccaa ggtgccgaaa       120
     ggcccgactt cattggatga cccggtttgg caaaaggcaa aacccctcga cattcccttt       180
     gcgggcaaag agaagtttgc cggcaagaag gcgaacgtaa tcactcaggc cgtctacacc       240
     gacgacgaga ttttttttct cttcaagtgg aaggatgcca ccaacagtgt gaccaaaggg       300
     gcgtggcagt tcgatggtga aaaatggacc catctgaaag gcgacgagga tcggatttcg       360
     ctgctcttcg agatcaatcg gatcaacaac tttgccacca aggggtgcgc tgtgacctgc       420
     cacggggccg caggagcagc ggtgaaggac ttcaaattcg ctactgcatc ggcgggtgag       480
     aagggcgacc tgtggcactg gaaggcggcc cgctccgacc cgtacaagtc cgccgacgat       540
     gggtggttga ccgcagccgg cgaaaaaacc ggtcgtaagg acgatgccgg cggcgggggc       600
     gatgcccgca acgaaaccgc cgataaatca aagccgcaat tcatgcagga cccctcaaag       660
     aaaccgtccg cccccggcgt acttcttgcc gaagacacgg tcgagattac cgatcatggg       720
     aaattcaagg ccaacgatac cctcacctat cggatgccga agaaaccgtc cggatctcga       780
     gctgatatca aggctgaaag tcgttacgcc gacggaggtt ggacggtgat gctctcccgc       840
     aagctggaca ccggaaacga cgacgatgtc gccttcaaca ccaagaagaa gtacagcttt       900
     gccttggcgc ttttcgacga ttcaatggac tacgattcct atgactccga agccctggtg       960
     ctcgaattcg gccgttag                                                     978
//

If you have problems or comments...

PBIL Back to PBIL home page