(data stored in ACNUC7421 zone)

EMBL: CP000478.PE44

CP000478.PE44        Location/Qualifiers
FT   CDS_pept        complement(60382..60672)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sfum_0045"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sfum_0045"
FT                   /db_xref="EnsemblGenomes-Tr:ABK15748"
FT                   /db_xref="GOA:A0LE96"
FT                   /db_xref="UniProtKB/TrEMBL:A0LE96"
FT                   /protein_id="ABK15748.1"
FT                   /translation="MRECPKCGHVRRQEDDGFVPAEECPKCGVIYSRARPDVSLQPYSN
FT                   RPAGKGIGETIKFVLLIALVLIGFYLWTHYYGSSAEGKSTFGLEFLMVPRG"
     atgagggagt gcccaaaatg cggccacgtg cggcgacaag aggatgatgg cttcgtgcct        60
     gcggaggaat gccccaagtg cggtgtgata tactccaggg ccaggcccga cgtatctctg       120
     cagccctatt caaaccgacc ggccggcaag ggaatcggcg aaaccatcaa gtttgtgctg       180
     ttgatcgccc tggtgctcat cggcttctac ctctggactc actactacgg gagctccgcg       240
     gaagggaaga gcaccttcgg gttggaattc ctcatggtcc cacggggata a                291
//

If you have problems or comments...

PBIL Back to PBIL home page