(data stored in ACNUC7421 zone)

EMBL: CP000478.PE440

CP000478.PE440       Location/Qualifiers
FT   CDS_pept        534682..535686
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sfum_0444"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: dps:DP3001 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sfum_0444"
FT                   /db_xref="EnsemblGenomes-Tr:ABK16144"
FT                   /db_xref="GOA:A0LFE2"
FT                   /db_xref="InterPro:IPR019020"
FT                   /db_xref="UniProtKB/TrEMBL:A0LFE2"
FT                   /protein_id="ABK16144.1"
FT                   /translation="MKAGIARALTLVLVVALGVILTGRCHLEAAEPSWVVTAKYLQKAP
FT                   TGLDDPAWQQVRPVEVRLKGRGSFAEEEVTVTAMAAYTAESIYFLFKWKDPTESVVKQS
FT                   WKFDGQNWTHMKGDEDRIALLFEISRINGFATKGCTVVCHSPPDVPSKEWKFATETPAE
FT                   KGDLWHWKAARSNPYHHADDGWLTLADNPSGSYRTTGRRADGGGGGDVNNETPDKTRPL
FT                   YMQDPSRIPSAPGFLLFEEAVNIPDDAVFKAGDIIPYRMPKKPDGSRSDVKAIGQYADG
FT                   GWTVMLYRKLDTGREDDVAFNPRKEYSFAMAVFDDSGDDHSKATRAMILRFSR"
     atgaaagcgg ggattgccag ggcactgacc ttggttctgg tcgttgccct cggggtgatt        60
     cttacaggac gctgtcattt ggaagcggcc gagccgtcgt gggtcgtcac cgccaaatat       120
     ctccagaagg ctccaaccgg gctggatgat cctgcctggc aacaggtgcg cccggtcgaa       180
     gtccggttga agggcagggg aagctttgca gaagaggaag taacggtgac cgcgatggcc       240
     gcatataccg ccgaaagcat ctattttctg ttcaagtgga aagatcctac ggagagcgtg       300
     gtcaagcaat cctggaaatt cgacggccaa aactggaccc acatgaaggg cgacgaggac       360
     cggattgcgc tactttttga gatcagccgg atcaacgggt tcgccaccaa gggctgcacc       420
     gtggtctgcc acagtccccc tgatgttccc agcaaagaat ggaaatttgc caccgagacc       480
     cccgctgaaa aaggggacct gtggcattgg aaggcggccc gctccaaccc ttaccatcac       540
     gccgatgacg gttggctaac attggccgac aacccctccg gctcctatcg gaccaccggg       600
     cgcagagcgg atggcggcgg cggcggcgac gtcaataacg aaaccccaga caagaccagg       660
     cccctctata tgcaggaccc gtcgcggatt ccttccgcgc cgggctttct gctttttgaa       720
     gaagcggtca atattcccga cgacgcggtg ttcaaagcgg gcgatatcat cccataccgc       780
     atgcccaaga aaccagacgg ttcccgctcc gacgtgaagg ccatcggtca atatgccgac       840
     ggcggttgga ccgtcatgct ttaccgaaag ctcgacacgg ggcgcgaaga tgatgtagcg       900
     tttaatcctc gcaaggaata cagcttcgcc atggccgtat tcgacgactc aggcgatgat       960
     cattcgaagg cgacccgggc aatgatcctg aggttcagcc gctga                      1005
//

If you have problems or comments...

PBIL Back to PBIL home page