(data stored in ACNUC7421 zone)

EMBL: CP000478.PE442

CP000478.PE442       Location/Qualifiers
FT   CDS_pept        537513..538175
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sfum_0446"
FT                   /product="transcriptional regulator, TetR family"
FT                   /note="PFAM: regulatory protein, TetR; KEGG: dvu:DVU0436
FT                   transcriptional regulator, TetR family"
FT                   /db_xref="EnsemblGenomes-Gn:Sfum_0446"
FT                   /db_xref="EnsemblGenomes-Tr:ABK16146"
FT                   /db_xref="GOA:A0LFE4"
FT                   /db_xref="InterPro:IPR001647"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR015292"
FT                   /db_xref="InterPro:IPR023772"
FT                   /db_xref="InterPro:IPR036271"
FT                   /db_xref="UniProtKB/TrEMBL:A0LFE4"
FT                   /protein_id="ABK16146.1"
FT                   /translation="MGMLKGGGRSADTRERLLEAAGETFAARGFRDATVREISRRAGVN
FT                   VAAVNYYFGDKEGLYSAVLKYTLDSALKKYPPDLGLDGDATAEDRLYAFIRSMLYRVTD
FT                   EGRPAWHGKLMIREIAQPTKALDEMVLTGFGPLHRSLMSIVRELAGAGGDEEQIRLCAM
FT                   SILGQCLYYHLCRPVLKALYAQSFDVPEIERLAGHIMRFSLNGLRVLQAKTDNPRMG"
     atgggcatgc tgaaaggcgg cggcaggagc gcagacacca gggaacggct gctcgaagcg        60
     gccggggaga cgttcgcggc gcgcgggttc cgcgatgcca cggtgcggga gatctcccgg       120
     cgggccgggg tgaacgtcgc cgccgtgaat tactactttg gggacaagga aggactctat       180
     tcggcggtcc tcaagtacac gctggattcg gcactgaaga aatatccgcc cgatctgggc       240
     ctcgacggcg acgcgacggc cgaggacagg ctttacgcgt tcatccgttc catgctctac       300
     cgggtcacgg atgaagggcg gccggcgtgg cacggcaaac tgatgatcag ggaaatcgca       360
     cagcccacga aagcgctcga cgaaatggtg ctgacggggt tcggcccgtt gcacaggagc       420
     ctgatgtcca tcgtccggga gcttgcgggg gcgggcgggg acgaggagca aatccggctt       480
     tgcgcgatga gcatcctcgg ccagtgtctg tactatcacc tgtgccggcc ggtgctcaag       540
     gcactgtatg cccagtcttt cgacgttccc gaaatcgaac ggctggcggg gcacatcatg       600
     cgcttttcac tgaacggatt gagggtactg caggcgaaaa cggacaatcc gcgcatgggt       660
     tga                                                                     663
//

If you have problems or comments...

PBIL Back to PBIL home page