(data stored in ACNUC7421 zone)

EMBL: CP000478.PE443

CP000478.PE443       Location/Qualifiers
FT   CDS_pept        538393..539931
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sfum_0447"
FT                   /product="transcriptional regulator, Fis family"
FT                   /note="TIGRFAM: RND efflux system, outer membrane
FT                   lipoprotein, NodT family; PFAM: outer membrane efflux
FT                   protein; KEGG: dde:Dde_0400 RND efflux system, outer
FT                   membrane lipoprotein, NodT"
FT                   /db_xref="EnsemblGenomes-Gn:Sfum_0447"
FT                   /db_xref="EnsemblGenomes-Tr:ABK16147"
FT                   /db_xref="GOA:A0LFE5"
FT                   /db_xref="InterPro:IPR003423"
FT                   /db_xref="InterPro:IPR010131"
FT                   /db_xref="UniProtKB/TrEMBL:A0LFE5"
FT                   /protein_id="ABK16147.1"
FT                   /translation="MIDLQGMKRFRWTRSLILGLVAVVGGCMVGPNYRTPPSEMPGQWS
FT                   EEPKGVEVAAAPDISRWWTLFEDPKLNDLIERAVRANKDLKIAAARVREARAQRGVTAA
FT                   DLFPTVNADGSYVYSQKSLTTTNPPLVSSGSSPAATVGGVSTGSTNLFQVGFDAGWELD
FT                   LWGGTRRAVEAADANLAASVENLRGVLVTLVSDVAVSYMQIRGFQLRLGIARNNIASQR
FT                   QTLELTEARFEAGLSSELAVAQQKAQLAATEATVPAFESGMRQAIHQLGVLLGGKPELL
FT                   LEELLEEEPIPPVPPGVPAGLPSDLLRQRPDIRASERQLAAATASIGVATAQLFPQFSL
FT                   TGTVGQQSMFSSKWFTPGSNYFSIGPSVSWAIFDAGRIRWNIKVQDARQEQAFHTYEKT
FT                   ILVALKDVEDALIAYSKEQDTRESLKLAVDSNRRAYDISYELYAKGLVDFLNVLDAQRN
FT                   LFVTQDQYAQSTLRVSADLVALYKALGGGWDVPPEAAARPVARNAPENPVGQGQ"
     atgattgacc ttcagggaat gaagcggttt cggtggaccc ggagcctgat actggggctg        60
     gtcgccgtag tcggcggatg catggtgggc ccgaattaca ggacgccgcc ctcggagatg       120
     cccggacagt ggagcgagga gcccaagggg gtcgaagtcg ccgcggcgcc tgacatttcg       180
     cgatggtgga ccctctttga ggacccgaag ctgaacgacc tcatcgaacg ggcggtccgc       240
     gcgaacaagg atctgaaaat cgccgcggcc cgggtccggg aagcccgcgc ccagcggggc       300
     gtgaccgcgg cggatctttt ccccacggtg aacgcggacg ggagttatgt gtacagccag       360
     aagagcctga ccaccacgaa tccgccgctc gtgtcctcgg gaagcagccc cgcggcaacc       420
     gtcggcggag tctcaaccgg ctcgaccaac cttttccagg tcgggttcga cgccggctgg       480
     gaactggacc tgtggggggg cacgcggcgc gcggtggaag ccgcggacgc caatctcgcc       540
     gccagcgtgg aaaacctccg gggcgtcctg gtgacgctgg tctccgacgt cgcggtgagc       600
     tacatgcaga ttcgcggctt tcaactccgc ctggggatcg cccggaacaa catcgcctcg       660
     cagcggcaga ccctggagtt gaccgaggcg cggttcgagg cgggtttgag cagcgaactg       720
     gccgtcgcgc agcagaaggc gcaactcgcg gccaccgaag ccacggttcc ggcctttgag       780
     agcggcatgc ggcaggccat ccaccaactc ggcgtgctcc ttggcggcaa gccggaattg       840
     ctgctcgaag agcttctcga ggaggagccg ataccgcccg tgccgcccgg cgtgcctgcc       900
     gggttgcctt ccgacctgct gcggcagcgg cccgacatcc gcgcatccga aaggcagctt       960
     gcggcggcaa ccgcaagcat cggcgtggcc acggcgcagc tttttccgca attcagcctg      1020
     accggcacgg tgggacagca gagcatgttt tcatcgaaat ggttcacgcc cggcagcaac      1080
     tacttcagca tcggtccttc ggtgagttgg gcgattttcg atgccggcag gatccggtgg      1140
     aatatcaagg tgcaggacgc ccgccaggag caggctttcc acacgtacga aaagacgatt      1200
     ctcgtggctc tgaaggatgt ggaggatgcc ctgatcgcgt actccaagga acaggatacc      1260
     cgggagtccc tcaagcttgc agtggattcg aaccggcgtg catacgacat ttcctacgaa      1320
     ctgtacgcaa agggactcgt ggacttcctc aacgtgctcg acgcccagcg caacctcttt      1380
     gtcacgcagg atcaatacgc tcaaagtacc cttcgggtgt ccgccgatct cgtggccctg      1440
     tacaaggccc tcgggggcgg atgggatgtg ccgcccgaag cagccgcccg tccggtggct      1500
     cggaatgctc ccgagaaccc ggtcggccag gggcaataa                             1539
//

If you have problems or comments...

PBIL Back to PBIL home page