(data stored in ACNUC7421 zone)

EMBL: CP000478.PE445

CP000478.PE445       Location/Qualifiers
FT   CDS_pept        540969..541946
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sfum_0449"
FT                   /product="Transketolase domain protein"
FT                   /note="PFAM: Transketolase, central region; Transketolase
FT                   domain protein; KEGG: bha:BH0777 acetoin dehydrogenase
FT                   (TPP-dependent) beta chain"
FT                   /db_xref="EnsemblGenomes-Gn:Sfum_0449"
FT                   /db_xref="EnsemblGenomes-Tr:ABK16149"
FT                   /db_xref="GOA:A0LFE7"
FT                   /db_xref="InterPro:IPR005475"
FT                   /db_xref="InterPro:IPR009014"
FT                   /db_xref="InterPro:IPR029061"
FT                   /db_xref="InterPro:IPR033248"
FT                   /db_xref="UniProtKB/TrEMBL:A0LFE7"
FT                   /protein_id="ABK16149.1"
FT                   /translation="MQQLTMGQAVNQALREEMLRDPNVFIAGEGVGVSIHAAPVLPTFG
FT                   LLEEFGPDRVKDTPVSEAAIAGLAVGASVMGLRPVVEIMFNPFVTLASDMIVNHAAKLR
FT                   YLSGGKSTFPMVVRIKSGAGFKAGCQHSHNLEAWLAHCPGIRVVMPSTPADAKGLLKSA
FT                   IRDDNPVVFIEDMLLYFVPGPVPEEEYLVPIGKADVKRQGSDVTIVTWSKMLGAAMKGA
FT                   ALLEQKGVSAEVIDLRTLAPLDKDAILDSVRKTGRLVVLHEATRTGGFAGEICALVAEE
FT                   ALGSLKAPFRRVTGPDIPVPFSPPLEAFYIPDEHDLVKAVESIV"
     atgcagcaac tgaccatggg acaggcggtg aaccaggcgc tcagagagga aatgcttcgc        60
     gacccgaatg tttttatcgc gggcgagggc gtcggggtga gcattcacgc cgctccggtc       120
     cttcccacct tcggactgct ggaggaattc ggcccggatc gggtgaagga tacgccggtt       180
     tcggaggcgg ccatcgccgg actggcggtc ggcgcctccg tgatgggatt gaggccggtg       240
     gtggaaatca tgttcaatcc tttcgtgacc ctcgcttcgg acatgatcgt caatcatgcc       300
     gcaaagctcc ggtacctgtc gggcgggaag agcactttcc ccatggtggt gaggataaag       360
     agcggggccg ggttcaaggc gggatgccaa cattctcata acctggaagc ctggctcgcg       420
     cactgtccgg gaatcagggt ggtgatgcct tcaaccccgg cggatgccaa gggcctgctc       480
     aagtccgcca tacgggacga caatcccgtg gtgttcatcg aagacatgtt gctctatttc       540
     gtgcccggac cggtgcccga agaggaatac ctggttccca tagggaaggc ggacgtcaaa       600
     cggcagggtt ccgacgtcac catcgtgacc tggtccaaga tgctgggagc ggccatgaag       660
     ggcgccgcgc tgctggaaca aaagggtgta tccgccgagg tgatcgatct gcgcaccctc       720
     gcgccgctcg ataaggatgc gattctcgat tccgtgagaa agaccggccg gctggtggtg       780
     ctccacgagg ccacgcgaac gggcgggttt gccggagaaa tctgcgccct ggttgccgaa       840
     gaagcgctgg gcagtctcaa agcgcctttc cgacgggtga ccggcccgga catccccgtg       900
     cctttcagcc cgccgctcga agcgttctac atccccgacg agcacgacct ggtaaaggcg       960
     gtggaaagca tcgtctga                                                     978
//

If you have problems or comments...

PBIL Back to PBIL home page