(data stored in ACNUC7421 zone)

EMBL: CP000478.PE447

CP000478.PE447       Location/Qualifiers
FT   CDS_pept        543579..546746
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sfum_0451"
FT                   /product="acriflavin resistance protein"
FT                   /note="PFAM: acriflavin resistance protein; KEGG:
FT                   dvu:DVU0438 AcrB/AcrD/AcrF family protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sfum_0451"
FT                   /db_xref="EnsemblGenomes-Tr:ABK16151"
FT                   /db_xref="GOA:A0LFE9"
FT                   /db_xref="InterPro:IPR001036"
FT                   /db_xref="InterPro:IPR027463"
FT                   /db_xref="UniProtKB/TrEMBL:A0LFE9"
FT                   /protein_id="ABK16151.1"
FT                   /translation="MNITELFIRRPVATTLVMLAILLFGLMGYRSLPVSELPNVDYPTI
FT                   EVSSNLPGSNPETMAASVATPLEREFSTIAGLDSMTSVNALGITRITLQFSLDRDIDAA
FT                   AQDVQTAIAKSQRLLPPELPTPPWFRKVNPADQPILYLALASPILPLSTVDEYAQTLVA
FT                   QRISMLGGVAQVLVFGSQKYAVRVQVNPNALTSLGIGIDEVEQAIAKSNVNLPTGTLYG
FT                   QNRAFTVQATGQLVNAASYKPVIVAYRNGSPVRLQDLGKVIDGVENDKVAGWFNSGGNT
FT                   SRAIILAIQRQPGTNTVQVADRIKGLLPMFRMQIPESVKLDILYDRSESISHSIEDVKF
FT                   TLYLSMCLVVLVIFLFLRNVSATIIPSLALPLSIVGTFAVMYMLGYSLDNLSLMALTLS
FT                   VGFVVDDAIVMLENIVRHLEMGKSKLQAALDGSREIGFTILSMTLSLAAVFIPLLFMGG
FT                   ILGRLFHEFAVTIGAAILVSGVVSLTLSPMLCSRFLKAPGAERHGAFYNTAERFFQGML
FT                   GAYDWSLKLVLRHKASMMLLSAVLLIATGYLFWAIPKDFIPSQDTGQVQGFTEARQGIS
FT                   FAAMVERQKAVAAIINKDPDVAGFMSGAGATGGTPTGNSGRLFMRLKPRSERESNVTEV
FT                   IARLRGEVAAVPGINVYFQNPPAIQIGGRATKSQYQYTLQGPDTKELYQWAPALEEKFR
FT                   ELPGLQDVVSDLQITNPQVVVDIDRDKAQSLGVSAEQIENALYSAYGARQVSTIYTPIN
FT                   QYQVILEVDPKYQEDPSALSLLYVRSSSGRLVPTEAVAKIRQNVGPMTVNHTGQFASVT
FT                   VSFNLKPGVALGDAVDQIEKAVRELRLPATLSSSFQGTAQQFQQSMKGMWVLLIVAIMV
FT                   IYMVLGILYESFIHPVTILSGLPSAGVGALLTLMIFRVDLSIYAFVGIIMLVGIVKKNA
FT                   IMMIDFALSAQREYGKSPAEAIYEGCILRFRPIMMTTMAALMGTLPIALGIGAGAEARQ
FT                   PLGLAVVGGLVLSQLLTLYITPVVYLYMESFQEMLRRVFKPAARKATPEAVGSEVMERP
FT                   RRKTSAL"
     atgaatatca ccgaactgtt catccgacgg cccgttgcga cgacgctggt gatgctggcg        60
     atcctgctct tcggcctgat gggataccgg tcgctgccgg tgagcgagct gcccaacgtg       120
     gactatccca ccatcgaggt ttcgtcgaac ctgcccggct cgaacccgga gaccatggcc       180
     gcgtcggtgg cgacccccct ggaacgggag ttttccacta tcgcggggct ggattcgatg       240
     acctcggtca atgcgctggg gatcacccgg atcacgctgc agttctcgct cgatcgggac       300
     attgacgccg cagcccagga tgtccagacc gccatcgcca agtcccagcg tctcctgccg       360
     ccggagcttc ccacgccccc ctggttccgc aaagtgaatc ccgcggacca gcccatcctg       420
     tacctggcgc tggcctcccc catactcccg ctttccacgg tggacgagta tgcccagacg       480
     ctcgtcgccc agaggatttc gatgctcggc ggcgtggccc aggtgctggt cttcgggtcg       540
     cagaaatatg ccgttcgcgt gcaggtcaac cccaatgcgc tcacctcgct tggcatcgga       600
     atcgacgaag tcgaacaggc gatcgccaag agcaacgtga acctgccgac cggaacgctc       660
     tacggtcaaa accgggcatt cacggttcag gccacgggac agcttgtcaa cgccgcttcc       720
     tacaagccgg tgatcgtggc ctaccgcaac ggctctccgg tccgtctcca ggacctggga       780
     aaagtcatcg acggcgtcga gaacgacaag gtggccgggt ggttcaacag cgggggaaac       840
     acgtcgcggg cgattattct ggccatccag aggcagcccg ggaccaacac cgtccaggtc       900
     gccgaccgca tcaagggact tctgccgatg ttccggatgc agatcccgga atcggtcaaa       960
     ctggatatcc tctacgatcg ttccgaatcg atcagccatt ccatcgagga cgtcaagttc      1020
     acgctatact tgagcatgtg ccttgtcgtg ctggtgattt ttctttttct gagaaacgtg      1080
     tccgcgacca tcatcccttc ccttgcgctg cccctgtcca tcgtgggaac attcgcggtg      1140
     atgtacatgc tgggctacag cctcgacaac ctgtcgctca tggcgctgac cctctcggtg      1200
     gggttcgtcg tcgacgacgc catcgtcatg ctcgaaaaca tcgtccggca cctggagatg      1260
     ggcaagagca aactccaggc cgcgctcgac ggctccaggg aaatcggttt caccattttg      1320
     tccatgactt tgtccctggc ggccgtgttc attcccctcc tgttcatggg gggcatcctg      1380
     ggaaggcttt tccacgaatt cgcggtcacc atcggggcgg ccatcctcgt ttccggggtc      1440
     gtgtccctga ccctctcgcc gatgctgtgc agcaggtttc tgaaagctcc cggcgccgaa      1500
     cggcacggtg ccttctacaa cactgccgaa cggttcttcc aggggatgct cggcgcgtac      1560
     gactggagcc tgaagctcgt cctcaggcac aaggcttcca tgatgctcct ttcagccgtc      1620
     ttgctgatcg ctaccggata ccttttctgg gcaattccga aggatttcat ccccagccag      1680
     gatacgggac aggtgcaggg tttcaccgag gccaggcagg gcatttcctt cgcggccatg      1740
     gtcgaacgcc agaaagcggt ggccgcgatc atcaacaagg atccggacgt cgccggtttc      1800
     atgtcgggcg ccggagccac gggaggaacc cccaccggga acagcggccg cttgttcatg      1860
     cggttgaaac cgcgatccga gcgcgaatcg aacgtgaccg aggtgattgc ccggctgcgc      1920
     ggggaggtgg ccgcggtccc gggaatcaat gtctatttcc agaacccgcc ggcgattcag      1980
     atcgggggga gggcaaccaa gagccagtat caatacaccc tccagggacc ggacacgaag      2040
     gagctctacc agtgggcgcc cgcgctcgag gaaaaattca gagaactgcc cggactgcag      2100
     gacgtggtga gcgatctgca gatcacgaat cctcaggtgg tcgtcgatat tgaccgtgac      2160
     aaggcgcagt ccctgggcgt ttcggctgaa cagatcgaga atgcgctcta cagcgcatac      2220
     ggtgcgcggc aggtctccac gatctacact ccgatcaacc agtaccaggt tattctcgag      2280
     gtcgatccga aataccagga ggacccctcc gccctgtccc tgctctatgt gcgatcgagc      2340
     agcggacgac tggtgcccac cgaggccgtg gcaaaaatca ggcagaatgt cggtcccatg      2400
     acggtaaacc acacgggaca gtttgcttcc gtcaccgtgt ccttcaatct gaagcccggg      2460
     gtcgcactcg gcgacgctgt ggaccagatt gagaaggccg ttcgggaact gaggctgccg      2520
     gccacgttga gcagcagctt ccaggggacc gcccaacagt ttcagcagtc catgaaaggc      2580
     atgtgggtcc ttttgatcgt tgccatcatg gtcatctaca tggtgctggg catcctttac      2640
     gaaagcttca tccaccccgt gaccatcctt tcagggcttc cgtcggcggg cgtgggagcg      2700
     ctgctcaccc tgatgatctt ccgcgtggac ctgagcatct atgcgtttgt gggaatcatc      2760
     atgctggtcg ggatcgtcaa gaagaatgcg atcatgatga tcgacttcgc cctgagcgct      2820
     cagagagagt acggcaaatc accggctgaa gccatttatg agggatgcat cctccgattc      2880
     agaccgatca tgatgaccac catggcggcg ctgatgggga cgctgccgat tgcgctcggg      2940
     atcggtgcgg gagcggaagc caggcagcct ctcggtctgg cggtcgtcgg aggcttggtg      3000
     ctctcgcaac tcctgacgct ttacatcacg ccggtcgtct atttgtacat ggagtcgttc      3060
     caggaaatgc tgagaagggt tttcaagcca gccgcccgca aagcgacgcc ggaagccgtt      3120
     gggagcgaag tcatggagag gccgcggcgg aaaacgtcgg cgttgtga                   3168
//

If you have problems or comments...

PBIL Back to PBIL home page