(data stored in ACNUC7421 zone)

EMBL: CP000478.PE448

CP000478.PE448       Location/Qualifiers
FT   CDS_pept        546877..547611
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sfum_0452"
FT                   /product="Methyltransferase type 12"
FT                   /note="PFAM: methyltransferase small; Methyltransferase
FT                   type 11; Methyltransferase type 12; KEGG: dvu:DVU2209
FT                   hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sfum_0452"
FT                   /db_xref="EnsemblGenomes-Tr:ABK16152"
FT                   /db_xref="GOA:A0LFF0"
FT                   /db_xref="InterPro:IPR019410"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:A0LFF0"
FT                   /protein_id="ABK16152.1"
FT                   /translation="MDELDTLMDLIRQKYEVEVVPLKIGDRTLRLLQLTDFEAYIERLV
FT                   DSGGVGIMDLPFWAKVWDSSFLLAWFLGKQPVVPGRRLLEIGAGMGVVGLYAALCGHRV
FT                   TLSDINEDALLFARANARLNGLTEMKILKLDWNDPSPFEPYDIVFGSEVIYDRKSYPLL
FT                   VRFLRRAVAPDGMIFLAKNQGLHAPRFFEELTRYFEFKEKVQEVRSCGEAEKICLYAIR
FT                   RKRSVPEESGVDSAACADGGGT"
     gtggacgagc tggacacatt gatggatctc atccggcaga agtatgaagt cgaggtggtg        60
     cccctcaaga tcggggacag aacccttcga ctcctgcaat tgacggattt cgaagcatac       120
     atcgaaagac tggtggattc gggcggcgtg ggcatcatgg atctgccctt ctgggccaag       180
     gtctgggatt cgagttttct gctcgcctgg tttctcggca agcagcccgt ggtgcccggt       240
     cggcggctgc tcgagatagg agcgggcatg ggagtggtcg gtctctatgc agctctttgc       300
     ggacaccggg tcactctcag cgacatcaac gaagacgcgc ttctttttgc cagggccaat       360
     gcccggctga acgggctgac ggaaatgaag atcctgaagc tcgactggaa cgatccctct       420
     cctttcgagc cctacgatat cgttttcggg tccgaagtga tctacgaccg gaagtcgtat       480
     cctctgctgg tccggttcct gcgcagggcc gtcgcacccg acgggatgat ctttctggca       540
     aagaaccagg gattgcatgc tccgaggttt ttcgaagagc tgaccaggta cttcgagttc       600
     aaggagaaag tgcaggaggt tcgaagctgc ggagaagctg agaagatatg tctctatgcc       660
     atacgccgca agcggagtgt ccccgaggaa tccggggtgg attccgctgc gtgcgcggac       720
     gggggcggaa cctga                                                        735
//

If you have problems or comments...

PBIL Back to PBIL home page