(data stored in ACNUC7421 zone)

EMBL: CP000478.PE451

CP000478.PE451       Location/Qualifiers
FT   CDS_pept        complement(549179..549583)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sfum_0455"
FT                   /product="methylmalonyl-CoA epimerase"
FT                   /EC_number="5.1.99.1"
FT                   /note="PFAM: Glyoxalase/bleomycin resistance
FT                   protein/dioxygenase; KEGG: tte:TTE1219 lactoylglutathione
FT                   lyase and related lyase"
FT                   /db_xref="EnsemblGenomes-Gn:Sfum_0455"
FT                   /db_xref="EnsemblGenomes-Tr:ABK16155"
FT                   /db_xref="GOA:A0LFF3"
FT                   /db_xref="InterPro:IPR017515"
FT                   /db_xref="InterPro:IPR029068"
FT                   /db_xref="InterPro:IPR037523"
FT                   /db_xref="UniProtKB/TrEMBL:A0LFF3"
FT                   /protein_id="ABK16155.1"
FT                   /translation="MKVLKLDHIGIAVNSIEECKKLYADILGLLHAGSETVAEQKVTTA
FT                   FFPVGDTEIELLESTAPDGPIAKYLEKKGEGVQHLAFRVDNIEAALAELKAKGIKLIDE
FT                   VPRRGAGGAKIAFLHPKSTFGVLVEISQRD"
     atgaaggttc tcaaactgga tcatatcggt atcgcggtga acagcatcga agaatgcaag        60
     aagctctatg cggacatcct cgggctgctc catgccggca gtgagaccgt cgccgagcag       120
     aaagtgacca cggcgttctt cccggtgggt gacaccgaga tcgagctcct cgaatccacc       180
     gcccccgacg gccccatcgc caaatatctc gagaagaagg gcgagggcgt tcagcacctc       240
     gctttccgtg tggacaacat cgaggcggcc ctggccgagc tcaaggccaa aggcatcaag       300
     ctgatcgatg aagtgccgcg gcgcggcgcc ggaggagcca agatcgcttt cctccatccc       360
     aagtccacct tcggggttct ggtcgaaata tcccagaggg actag                       405
//

If you have problems or comments...

PBIL Back to PBIL home page