(data stored in ACNUC7421 zone)

EMBL: CP000478.PE453

CP000478.PE453       Location/Qualifiers
FT   CDS_pept        complement(550963..551364)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sfum_0457"
FT                   /product="cobalamin B12-binding domain protein"
FT                   /note="PFAM: cobalamin B12-binding domain protein; KEGG:
FT                   aba:Acid345_1432 methylmalonyl-CoA mutase"
FT                   /db_xref="EnsemblGenomes-Gn:Sfum_0457"
FT                   /db_xref="EnsemblGenomes-Tr:ABK16157"
FT                   /db_xref="GOA:A0LFF5"
FT                   /db_xref="InterPro:IPR006158"
FT                   /db_xref="InterPro:IPR006159"
FT                   /db_xref="InterPro:IPR036724"
FT                   /db_xref="UniProtKB/TrEMBL:A0LFF5"
FT                   /protein_id="ABK16157.1"
FT                   /translation="MASKIKIIVAKPGLDGHDRGAKLLARIFAEAGMEVVYTGLRQTPE
FT                   MIVNAALQEDADVVGLSSLSGVHNYFFPRVVQLMREKGLKDVLIVGGGIIPQEDYEPLK
FT                   KAGVQGVFGPGTPTTEIVKFIQDNVRAKK"
     atggctagta agatcaaaat aatcgtcgca aaacccggtc ttgacgggca cgaccggggt        60
     gccaaactgt tggcgagaat atttgccgaa gctggaatgg aagtggtcta caccggcctg       120
     cgccagaccc ccgaaatgat cgtcaacgcc gctctgcagg aagatgccga cgtggttggt       180
     ctcagcagcc tttccggtgt acacaactac ttcttcccca gggtggtgca actgatgagg       240
     gagaagggac tcaaggacgt tctgatcgtc ggcggcggaa tcattcccca ggaagattac       300
     gaaccgttga agaaggccgg cgtccagggc gttttcggtc ccggcacgcc gacgactgaa       360
     atcgtgaagt tcattcagga caacgttcgc gccaagaagt ag                          402
//

If you have problems or comments...

PBIL Back to PBIL home page