(data stored in ACNUC7421 zone)

EMBL: CP000478.PE457

CP000478.PE457       Location/Qualifiers
FT   CDS_pept        complement(555407..557392)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sfum_0461"
FT                   /product="pyruvate carboxylase subunit B"
FT                   /EC_number="6.4.1.1"
FT                   /note="PFAM: biotin/lipoyl attachment domain-containing
FT                   protein; pyruvate carboxyltransferase; Conserved
FT                   carboxylase region; KEGG: mja:MJ1231 pyruvate carboxylase
FT                   subunit B"
FT                   /db_xref="EnsemblGenomes-Gn:Sfum_0461"
FT                   /db_xref="EnsemblGenomes-Tr:ABK16161"
FT                   /db_xref="GOA:A0LFF9"
FT                   /db_xref="InterPro:IPR000089"
FT                   /db_xref="InterPro:IPR000891"
FT                   /db_xref="InterPro:IPR001882"
FT                   /db_xref="InterPro:IPR003379"
FT                   /db_xref="InterPro:IPR011053"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="UniProtKB/TrEMBL:A0LFF9"
FT                   /protein_id="ABK16161.1"
FT                   /translation="MENKHLHGTSLIAKLQDDPKVKVDNPIKIGDLTFRDGHQSLFATR
FT                   GRTEDLLPIAEEMNKIGYWSMEVWGGATFDTMHRFLNEDPWERPRQLKKYLKDTPMMML
FT                   LRGQNLVGYRNYADDMAEAFVDRACINGIDIFRTFDAVNDFRNFETVIKPIKKHKKHFQ
FT                   GTICYSLTEPRMGGPVYNLDYYVKKAKQLENMGADTVCIKDMAGLIAPYDAYYLVKALK
FT                   ENVKVPIHLHSHFTSGMADLALLKAIEAGVDIVDTCLAPWAYRSSHPAIEPLVMTLRHT
FT                   SRDTGFDLHQLAKCSTHFEKVSPKYRHLLDDRMATIDIGVLLHQTPGGMLSNLINQLRD
FT                   MGASDKLDAVFKALPQVRKEMGQVPLVTPTSQIVGIQAVNNVLFDTPQERYKMISAQSK
FT                   DLFYGLYGETPVPVDPEIQKKALKGYPRGETPTTARPADVLEPEMEKNWKDMEGLAKDI
FT                   DDVLIYGMYPMTGKRFLNWKYGKEPVPKEVMPKTLEDCAKEADLVKKAKAGLLVEKPTK
FT                   VAPEKGPGLRTFSVFVDEEFFEVGVEQIGGAPAITSITPMVAPVAAPAAAPAAAPKPAA
FT                   APAAAPKPAAAPVEGGTKLEAPMPGMVIRYEVKEGDSVKEGDVVMILEAMKMENSITAP
FT                   AAGVIKQICCKDGQSVQKGDVLAVIG"
     atggagaaca aacatctgca cggcacgtca ttgatcgcga agctgcagga cgatccaaaa        60
     gtgaaagtgg acaacccgat caaaatcgga gaccttactt tccgtgacgg acatcaatcg       120
     ctcttcgcca cccgcggaag aacggaagac cttttgccga tcgccgagga aatgaacaaa       180
     atcggatact ggtcgatgga agtctggggc ggagcgactt tcgatacgat gcaccgtttt       240
     ctcaatgaag acccctggga aagaccgcgc cagttgaaga agtatctcaa ggacaccccc       300
     atgatgatgc tgcttcgcgg tcagaatctg gtcggatacc gcaactacgc cgacgacatg       360
     gccgaagcct tcgtcgaccg cgcctgcatc aacggcatcg acattttccg cactttcgac       420
     gcggtcaacg acttccggaa ttttgaaacc gttatcaagc ccatcaagaa acacaagaag       480
     cacttccagg ggaccatttg ctactccctg accgaacccc gcatgggcgg cccggtgtac       540
     aacctggact attacgtcaa gaaagccaag cagttggaaa acatgggcgc ggataccgtc       600
     tgtatcaagg acatggccgg tttgatcgcc ccttacgacg cctactacct ggtcaaggcc       660
     ttgaaagaaa acgtcaaggt ccccattcat ctccacagcc atttcacctc cggcatggcc       720
     gacctggcgc tgctcaaggc gatcgaagcc ggtgtcgata tcgtcgatac ctgtcttgct       780
     ccgtgggcgt atcgcagctc ccatccggcc atcgagcccc tggtcatgac cctcaggcac       840
     accagcaggg acacgggttt cgacctccat cagcttgcaa agtgcagtac gcacttcgag       900
     aaggtgtccc cgaagtaccg ccatcttctc gatgaccgta tggccacgat cgacatcggc       960
     gttctgctgc atcagacgcc gggcggcatg ctgtccaacc tgatcaatca gctgcgcgac      1020
     atgggcgcct ccgacaagct ggacgccgtg ttcaaggcac tgccgcaggt ccgcaaggaa      1080
     atgggccagg ttcccctggt gaccccgacc agccagatcg tcggcatcca ggccgtgaac      1140
     aacgttcttt tcgacacccc gcaagagcgt tacaagatga tctccgcgca gagcaaggac      1200
     ctgttctacg gtctgtacgg cgaaaccccg gttcccgtgg atccggaaat ccagaagaag      1260
     gcgctcaaag gctatcctcg cggtgaaacc ccgacgaccg cccgccccgc cgacgtgctg      1320
     gaaccggaaa tggaaaagaa ctggaaggat atggaaggtc ttgccaagga catcgacgac      1380
     gttctgatct acggcatgta ccccatgacc ggcaagcgct tcctcaactg gaagtacggc      1440
     aaggagccgg tgcccaagga agtcatgccc aagaccctcg aggattgcgc aaaagaggcg      1500
     gatctggtca agaaagccaa ggccggcctc ctcgtcgaga agccgaccaa ggtcgctccc      1560
     gaaaagggac ccggtctgcg caccttcagc gtgtttgtgg atgaggagtt cttcgaggtc      1620
     ggcgtcgagc agatcggcgg cgctcccgcc atcacttcca tcacccccat ggttgctcct      1680
     gtagcggctc ccgccgcagc ccccgccgca gcccccaagc ctgcggcagc acccgctgca      1740
     gctcccaagc ccgcggccgc tccggtcgag ggtgggacca agctggaagc tcccatgccg      1800
     ggcatggtca ttcgctacga agtgaaggaa ggcgattcgg tcaaagaggg cgacgtcgtg      1860
     atgatcctcg aggccatgaa gatggaaaac tccatcacgg cccccgctgc cggcgtcatc      1920
     aagcagattt gctgcaagga cggccagagc gtgcagaagg gtgacgtgct ggcggtcatc      1980
     ggctag                                                                 1986
//

If you have problems or comments...

PBIL Back to PBIL home page