(data stored in ACNUC7421 zone)

EMBL: CP000478.PE458

CP000478.PE458       Location/Qualifiers
FT   CDS_pept        complement(557623..557904)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sfum_0462"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sfum_0462"
FT                   /db_xref="EnsemblGenomes-Tr:ABK16162"
FT                   /db_xref="UniProtKB/TrEMBL:A0LFG0"
FT                   /protein_id="ABK16162.1"
FT                   /translation="MTIFSGGLLEWKRREKRKRWHLMRREYMQEKKKVVAAIATALAYY
FT                   MQAEEQAMLALQQQRAAQGPRQLFNPYALAGRTAAMDVRWTWQMRLAR"
     gtgacgattt tcagcggcgg cctgctggag tggaaacggc gcgagaagcg gaaacggtgg        60
     cacttgatga ggagggaata catgcaagaa aagaagaagg tggttgcggc tattgctaca       120
     gcattggctt actatatgca agccgaagaa caagccatgc ttgcgctcca gcagcaaagg       180
     gctgcacaag gaccgcgcca gctctttaat ccgtacgccc tggcgggcag aaccgccgcg       240
     atggatgtcc ggtggacctg gcagatgcgt ttggctcggt ag                          282
//

If you have problems or comments...

PBIL Back to PBIL home page