(data stored in ACNUC7421 zone)

EMBL: CP000478.PE46

CP000478.PE46        Location/Qualifiers
FT   CDS_pept        62717..63652
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sfum_0047"
FT                   /product="carbamate kinase"
FT                   /EC_number="2.7.2.2"
FT                   /note="PFAM: aspartate/glutamate/uridylate kinase; KEGG:
FT                   gme:Gmet_2786 carbamate kinase"
FT                   /db_xref="EnsemblGenomes-Gn:Sfum_0047"
FT                   /db_xref="EnsemblGenomes-Tr:ABK15750"
FT                   /db_xref="GOA:A0LE98"
FT                   /db_xref="InterPro:IPR001048"
FT                   /db_xref="InterPro:IPR003964"
FT                   /db_xref="InterPro:IPR036393"
FT                   /db_xref="UniProtKB/TrEMBL:A0LE98"
FT                   /protein_id="ABK15750.1"
FT                   /translation="MAVRKPILLVALGGNALIRKGQQGTIPEQLENLRVPLRQIARLAE
FT                   AHRIIITHGNGPQVGNLLLQQECCSEVPRLPLEILVAQTQGQIGYMIESTLDSELMSLG
FT                   VDKEHYIVSVLSYVVVNEDDPAFLHPSKPIGPAFNEAEAARLPYPTVRTDKGYRRVVAS
FT                   PKPVTIVEKREIKRLIDLGFIVISCGGGGIPVIRDSRTFHGVDAVIDKDLASARLAGEI
FT                   GVDIFLIATDVEGVALHYEQETRRSWLRSVSVGDAGRFLEEGHFPPGSMGPKVEACIEF
FT                   MKHGGTRAVIASIERIEAAVQGAAGTEFAP"
     atggctgtaa ggaaacccat ccttttggtc gccctgggcg gcaatgcgct cattcgcaag        60
     ggacagcagg gcacgatccc cgaacagctg gagaacctgc gcgttccgct gcgacagatc       120
     gcgcggctgg cggaagcgca ccggattatc atcacgcacg gcaacggccc ccaggtcggg       180
     aatctgttgc tgcagcagga atgctgttcc gaggttccga ggctgcctct cgaaatcctc       240
     gtggcccaga cgcagggcca gatcggctac atgattgaat ccactctgga cagcgagctc       300
     atgagcctcg gcgtcgacaa ggaacactac attgtgagtg tcctcagcta cgttgtggtg       360
     aatgaagacg acccggcctt cctgcatcct tcgaaaccca tcggcccggc cttcaacgaa       420
     gcggaggcgg cccggcttcc gtacccgacg gtgagaaccg acaaggggta ccggcgggtg       480
     gttgcgtccc cgaaaccggt cactatcgtg gaaaaaaggg aaatcaagcg gttgatcgat       540
     ctgggcttta tcgtcatttc ctgcggcggc gggggcattc cggtgatccg ggacagccgg       600
     acttttcacg gcgtggacgc cgtgatcgac aaggacctgg cgagtgcgcg gctggcgggg       660
     gagatcggcg tggacatctt tcttatcgcc acggacgtgg aaggcgtggc gctgcattac       720
     gaacaggaga cgcgccggag ctggctgcgc agcgtgagtg tcggcgatgc cggccggttc       780
     ctcgaggaag gacatttccc gccgggatcc atgggaccga aagtggaggc gtgcatcgaa       840
     ttcatgaaac acgggggaac acgcgccgta atcgcttcca tcgagcggat cgaggccgcc       900
     gtccaaggcg cggccggcac ggaattcgct ccgtga                                 936
//

If you have problems or comments...

PBIL Back to PBIL home page