(data stored in ACNUC7421 zone)

EMBL: CP000478.PE460

CP000478.PE460       Location/Qualifiers
FT   CDS_pept        complement(558393..559178)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sfum_0464"
FT                   /product="SPFH domain, Band 7 family protein"
FT                   /note="PFAM: band 7 protein; KEGG: sat:SYN_02180 membrane
FT                   protease subunit, stomatin/prohibitin -like protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sfum_0464"
FT                   /db_xref="EnsemblGenomes-Tr:ABK16164"
FT                   /db_xref="GOA:A0LFG2"
FT                   /db_xref="InterPro:IPR001107"
FT                   /db_xref="InterPro:IPR001972"
FT                   /db_xref="InterPro:IPR036013"
FT                   /db_xref="UniProtKB/TrEMBL:A0LFG2"
FT                   /protein_id="ABK16164.1"
FT                   /translation="MPIGVYIVVVLAVLFLATAIRVLNEYERGVIFRLGRVIRAKGPGL
FT                   IILIPMVDRMQKVSLRLVAADVPAQDVITRDNVSVKVSAVIYFRVVDPVKAVISAENYL
FT                   YATSQLAQTTLRSVCGQGELDDLLAERDKINSHIQEILDRHTEPWGVKVSVVELKHIDL
FT                   PQEMQRAMAKQAEAERERRAKIIGAEGEFQAASRLSEAAKIIQEHPVAIQLRYLQTLRE
FT                   ISSENNSTTIFPIPIDLFRPFIRLAELYDRKQEKEQPIG"
     atgcccatcg gcgtgtacat tgtggttgtg ctggccgtgc tgtttctcgc aactgccatt        60
     cgcgttttga acgaatacga gaggggcgtg atttttcggc tgggccgggt gatacgggcg       120
     aaggggccgg gcctgatcat actcattccg atggtcgacc gcatgcagaa ggtcagtttg       180
     cgcctcgtgg ccgcggatgt gcccgctcag gacgtcatca cgcgcgacaa cgtttcggtc       240
     aaggtcagcg cggtgatcta tttcagggtt gtggacccgg tgaaggcggt catttccgcg       300
     gagaattatc tttacgccac cagtcagctg gctcagacaa cgctgcgaag cgtctgcggc       360
     cagggagagc tggacgatct gcttgcggaa agagacaaga tcaattcgca catccaggag       420
     atactcgacc gtcataccga gccatggggc gtgaaggtgt ccgttgtcga gctcaagcat       480
     atcgacctgc cccaggagat gcagcgggcc atggcgaagc aggcggaagc cgagcgtgaa       540
     cgccgcgcca agatcatcgg ggcggaaggt gaattccagg cggcgtcccg gctgtcggaa       600
     gcggcgaaga tcatccagga acatcccgtg gcgatccagc tccggtacct gcagaccttg       660
     agggagattt cgtccgaaaa caattccacc acgatcttcc cgatacccat cgaccttttc       720
     aggccgttca tacgcctggc cgaactctac gacaggaaac aggaaaagga gcagccaatt       780
     gggtaa                                                                  786
//

If you have problems or comments...

PBIL Back to PBIL home page