(data stored in ACNUC7421 zone)

EMBL: CP000478.PE469

CP000478.PE469       Location/Qualifiers
FT   CDS_pept        567041..567817
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sfum_0473"
FT                   /product="protein of unknown function DUF140"
FT                   /note="PFAM: protein of unknown function DUF140; KEGG:
FT                   pca:Pcar_0447 putative ABC transport system permease
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sfum_0473"
FT                   /db_xref="EnsemblGenomes-Tr:ABK16173"
FT                   /db_xref="GOA:A0LFH1"
FT                   /db_xref="InterPro:IPR003453"
FT                   /db_xref="InterPro:IPR030802"
FT                   /db_xref="UniProtKB/TrEMBL:A0LFH1"
FT                   /protein_id="ABK16173.1"
FT                   /translation="MIRSLGAYTVVQVGFLGRLGLFLGRMLAGITRPPGKFLSVVKQIQ
FT                   FIGTKSFLVIGFTAIFTGMVLALQGYYALASVGSEGWLGKAVSLSLIRELGPVLTALMV
FT                   TGRAGSAMCAEIGIMRIDEQIDAIECMAIDPHSYLITPRLLAALIALPLLTAFCDVVGI
FT                   VGGYLVGVNLLGVNAGAYLDSMESSVVWKDVYMGIVKSICFGVLIIWICTYKGYYAGVD
FT                   ENNFGPEQVSRATTNAVVLSSISILVCDYVVTSVLL"
     atgatccgtt ccctcggtgc ctacacggtc gtccaagtgg gatttctcgg ccgtctcggc        60
     ctctttctgg gccgaatgct cgcgggcata accaggcctc ccggaaaatt cctttccgtc       120
     gtcaagcaga ttcagttcat cgggaccaag tcgttcctcg tcatcggctt caccgcgata       180
     ttcacgggga tggtactggc actgcaggga tattacgccc tggccagcgt gggatcggag       240
     gggtggctcg gcaaggcggt ctctttgagc ctgatccgcg agctggggcc cgtgctgacg       300
     gcccttatgg ttacgggccg ggccggctcc gccatgtgcg cggaaatcgg catcatgagg       360
     attgacgagc agatcgacgc catcgagtgc atggcgatag accctcattc ctatctgatc       420
     acccccaggc ttctggcagc gctgatcgcc ctgcctctgt tgacggcgtt ttgcgacgtg       480
     gtcgggatcg tcggcgggta cctggtcggc gtcaatctcc tgggggtgaa tgccggcgcc       540
     tacctggaca gcatggaatc aagcgtggtg tggaaggacg tctacatggg gatcgtgaaa       600
     tcgatctgct tcggggtcct gatcatctgg atctgcacct ataaaggtta ttatgcgggg       660
     gtcgatgaaa acaacttcgg cccggagcag gtgagtcgcg ccacgaccaa cgccgtggtg       720
     ctttcgtcga tttccattct cgtctgcgac tatgtcgtga cgtcggtgtt gctgtga          777
//

If you have problems or comments...

PBIL Back to PBIL home page