(data stored in ACNUC7421 zone)

EMBL: CP000478.PE470

CP000478.PE470       Location/Qualifiers
FT   CDS_pept        567833..568327
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sfum_0474"
FT                   /product="Mammalian cell entry related domain protein"
FT                   /note="PFAM: Mammalian cell entry related domain protein;
FT                   KEGG: sat:SYN_01264 ABC-type transport system involved in
FT                   resistance to organic solvents, periplasmic component"
FT                   /db_xref="EnsemblGenomes-Gn:Sfum_0474"
FT                   /db_xref="EnsemblGenomes-Tr:ABK16174"
FT                   /db_xref="GOA:A0LFH2"
FT                   /db_xref="InterPro:IPR003399"
FT                   /db_xref="InterPro:IPR030970"
FT                   /db_xref="UniProtKB/TrEMBL:A0LFH2"
FT                   /protein_id="ABK16174.1"
FT                   /translation="MERRGLEFGVGLFLLIGLACLGYLSFKLGHLNLWGGSDYPVTAKF
FT                   STVAGLKDKAKVFMAGVAIGEVQSIGLKDGEAVVTLSINKDVKLEDDVIASIKTSGLIG
FT                   DKYVSVTAGASDQYIKPGGAIRDTQPPLDIENLLGRFVFGSVEQPKGQGGEGKQDDGAL
FT                   R"
     atggagcgaa gagggttgga attcggtgtc ggattgtttt tactgatcgg tttggcctgc        60
     ctggggtacc tgtcgttcaa gctcggccat ctgaatctgt ggggagggtc tgactatccg       120
     gtcacggcaa aattttccac ggtggccgga ctgaaggaca aagccaaggt gttcatggcc       180
     ggcgtggcca tcggcgaggt acagagcatc ggcctgaaag acggagaggc ggtggttacg       240
     ctctccatca acaaggacgt caagctggaa gatgacgtca tcgccagtat caagacgtcg       300
     gggctcatcg gcgacaaata cgtgtccgtc accgcggggg cctccgacca gtacatcaag       360
     ccgggcggcg ccataagaga cactcagccg ccgctcgata tcgaaaacct gctgggcagg       420
     ttcgtgttcg gcagtgtgga acagcccaaa gggcagggcg gggaaggcaa acaggacgac       480
     ggcgcgctgc ggtag                                                        495
//

If you have problems or comments...

PBIL Back to PBIL home page