(data stored in ACNUC7421 zone)

EMBL: CP000478.PE473

CP000478.PE473       Location/Qualifiers
FT   CDS_pept        complement(570049..570765)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sfum_0477"
FT                   /product="5-formyltetrahydrofolate cyclo-ligase-like"
FT                   /note="KEGG: mmu:234814 methenyltetrahydrofolate synthetase
FT                   domain containing"
FT                   /db_xref="EnsemblGenomes-Gn:Sfum_0477"
FT                   /db_xref="EnsemblGenomes-Tr:ABK16177"
FT                   /db_xref="GOA:A0LFH5"
FT                   /db_xref="InterPro:IPR002698"
FT                   /db_xref="InterPro:IPR024185"
FT                   /db_xref="InterPro:IPR037171"
FT                   /db_xref="UniProtKB/TrEMBL:A0LFH5"
FT                   /protein_id="ABK16177.1"
FT                   /translation="MHPLDIADIVSRKDQLRTSFLSAGGRSPALPPEGAQGKAAERLRH
FT                   LPRYREAQSVMISPVSSLYQVRLNALTDRKRLVMPTPGLHKGFVVVEPGFIPPRQRHSA
FT                   VQPGPENPFATRMPYREPPGFLIDLIVTEGLMVGRDGGRLGDGSGHLDLQCAILSSLGW
FT                   LHPAFEVVGLVEDCRVVPSVPMKPGDVEIHWIVTPSRMERTPATAQARIGIQWDRLSLK
FT                   QIKRNDALFFLYRARS"
     atgcacccgt tggatattgc ggacatcgtt tcacggaaag atcaactgcg aacgagcttt        60
     ttgtcggccg ggggccgatc tccggcacta ccgcccgaag gtgcgcaggg aaaagcggca       120
     gagcgcctga gacatcttcc ccgctacagg gaagcgcaat cggtgatgat ctctccggtc       180
     tcttctcttt accaggtcag gttgaacgcg ctcaccgaca ggaagaggct cgtcatgccg       240
     actccgggac tccacaaggg ttttgtcgtc gtcgagcccg ggttcattcc gccgagacag       300
     aggcattccg ccgttcagcc gggtccggaa aaccctttcg cgacgcgcat gccctaccgg       360
     gaaccgccgg ggtttctcat tgacttgata gtgaccgaag gtttgatggt gggccgcgat       420
     ggcgggcgac tcggggacgg ttcaggccat ctggatttgc agtgcgcgat cctgagctcc       480
     cttggatggc tccacccggc ctttgaagtg gtcggcctcg tggaggattg ccgggttgtg       540
     ccttctgttc ccatgaagcc cggcgatgtg gagatccatt ggattgtgac gcccagccgc       600
     atggaacgca cgccggctac ggcgcaggcc cggatcggga ttcaatggga caggctgtcg       660
     ttgaagcaga taaagcgcaa cgatgcgctg ttttttctct atcgcgcgag aagttga          717
//

If you have problems or comments...

PBIL Back to PBIL home page