(data stored in ACNUC7421 zone)

EMBL: CP000478.PE479

CP000478.PE479       Location/Qualifiers
FT   CDS_pept        complement(579917..580696)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sfum_0483"
FT                   /product="imidazole glycerol phosphate synthase subunit
FT                   hisF"
FT                   /EC_number="4.1.3.-"
FT                   /note="TIGRFAM: imidazoleglycerol phosphate synthase,
FT                   cyclase subunit; PFAM: histidine biosynthesis; KEGG:
FT                   sat:SYN_01684 imidazole glycerol phosphate synthase,
FT                   cyclase subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Sfum_0483"
FT                   /db_xref="EnsemblGenomes-Tr:ABK16183"
FT                   /db_xref="GOA:A0LFI1"
FT                   /db_xref="InterPro:IPR004651"
FT                   /db_xref="InterPro:IPR006062"
FT                   /db_xref="InterPro:IPR011060"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="UniProtKB/Swiss-Prot:A0LFI1"
FT                   /protein_id="ABK16183.1"
FT                   /translation="MLSKRIIPCLDVRDGRTTKGIKFRNNVDIGDPVDMGRFYYEEGAD
FT                   EIVFYDITASSDRRGIMLDVVKRVAETIFIPFSVGGGIRTLEDMRDVLLAGAEKVSVNS
FT                   AAVLNPDIISQGAEAFGSQCIVLGMDVKHVAPSTRIPSGYEIVINGGRTTTGFDALWWA
FT                   LEAERLGAGEICLNSIDADGTRDGYELRLTRLISTSVRIPVIASGGAGTPNHLADVLKQ
FT                   GRADAALIASMVHYGTYSIRRIKQFLDDNGIRVRKTW"
     atgctgagca aacggatcat cccctgtctc gacgttcgcg acgggcggac aaccaagggg        60
     ataaaattca ggaacaacgt cgacatcggc gacccggtgg acatgggacg attctattac       120
     gaggagggcg ccgacgagat cgtgttctac gacatcaccg cgtcgagcga tcgtcggggc       180
     atcatgctgg acgtggtgaa aagggttgcg gagaccatct tcatcccctt ttccgtcggc       240
     ggagggatca ggaccctcga ggacatgcgg gacgtgctcc ttgcgggtgc cgagaaggtc       300
     agcgtgaatt ccgccgcggt gctcaatccc gatatcataa gccagggcgc ggaagcgttc       360
     gggagccagt gcatcgtcct ggggatggac gtcaaacacg tcgcgccctc caccaggatt       420
     ccttccggct acgagatcgt gatcaacggg ggccgcacga ccacgggatt cgatgcgctc       480
     tggtgggcat tggaggcgga gcgcctggga gcgggagaga tctgtctcaa ttcgatcgac       540
     gccgacggca cccgcgacgg ctacgagttg aggctgaccc ggctgatctc caccagcgtc       600
     cggatcccgg tcatcgcatc gggcggagcc ggaactccga atcatctggc cgacgtgctg       660
     aagcaaggcc gggcggacgc cgcgctcatc gcctccatgg tccactacgg cacctacagc       720
     atccgccgga tcaagcagtt tctggacgac aacggcataa gggtgcggaa aacctggtga       780
//

If you have problems or comments...

PBIL Back to PBIL home page