(data stored in ACNUC7421 zone)

EMBL: CP000478.PE482

CP000478.PE482       Location/Qualifiers
FT   CDS_pept        complement(584459..585718)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sfum_0486"
FT                   /product="Lytic transglycosylase, catalytic"
FT                   /note="PFAM: Peptidoglycan-binding LysM; Lytic
FT                   transglycosylase, catalytic; KEGG: bth:BT4487 putative
FT                   membrane-bound lytic murein transglycosylase"
FT                   /db_xref="EnsemblGenomes-Gn:Sfum_0486"
FT                   /db_xref="EnsemblGenomes-Tr:ABK16186"
FT                   /db_xref="InterPro:IPR008258"
FT                   /db_xref="InterPro:IPR018392"
FT                   /db_xref="InterPro:IPR023346"
FT                   /db_xref="InterPro:IPR036779"
FT                   /db_xref="UniProtKB/TrEMBL:A0LFI4"
FT                   /protein_id="ABK16186.1"
FT                   /translation="MLNRIGFRGVAPAVLGILLSIVCSGCTTTPQPSPSVSPQPQPPAA
FT                   REPVHVAPQAAPVSCAATFPYYPPPDRLDLCGEPVPLQHDSVRERFDREFTTVVYNHAQ
FT                   VYLWLKRMDRYFPQIEERLKSMGLPDDLKYVAIVESDLVPNVVSPKGAAGPWQFMPATG
FT                   SAYGLHQQGSIDKRYDFERSTISAFRYLSDLNRKYNNWALAIAAYNCGEKRILDESRAQ
FT                   GTRDYYHLKLPTETERYVMRILAVKAVLGNPTRYGYCLPKGMGYGELKVDRVTMNLSCS
FT                   TPIQTVAACAGTTYREFKRLNPEFRAEVIPSGCHEVKFPAGCGPAFEQNFSASRASMSS
FT                   SVPEPSSDEAPREPAQVRQPKPSPLKAKSRQPAETFHTVRKGDTLFSIARHYRVNAQDI
FT                   KKANRLRGNDIVPGQKLKIP"
     atgttgaatc gaatcggttt cagaggcgtt gctcccgccg tgctcggcat cctgctgtcc        60
     atcgtctgct cgggctgtac caccaccccg cagccatccc cgagcgtctc ccctcagcct       120
     cagcccccgg ccgccaggga acccgttcac gtcgcgccgc aggccgcacc cgtatcctgt       180
     gccgccacgt ttccatatta cccgcccccc gaccggctgg atctctgcgg ggagccggtt       240
     ccattgcagc acgactccgt gagggaacgc ttcgaccgtg agttcaccac ggtggtctat       300
     aaccatgccc aggtttacct ctggttgaag cgcatggatc gctatttccc gcaaatcgag       360
     gaacgcctga agtccatggg tctgccggac gacctgaagt acgtggcgat cgtggaaagc       420
     gacctggtgc cgaatgtggt ttcccccaag ggagcggccg gcccctggca gttcatgccc       480
     gcgaccggat ccgcctacgg cctgcatcag cagggctcca tcgacaagcg atacgatttc       540
     gagcgatcca cgatcagcgc tttccgatac ctgagcgatc tgaaccgcaa atacaacaac       600
     tgggcactgg caatcgccgc gtacaactgc ggcgaaaaac ggatcctgga cgaatcccgg       660
     gcacagggaa caagggacta ttaccacctg aagcttccga cggagacgga gcgctacgta       720
     atgcgaatcc tcgcggtcaa ggcggtcctc ggcaatccga cccgatacgg gtactgcctt       780
     cccaagggaa tgggctacgg tgagctgaag gtggaccgcg tgaccatgaa cctgtcctgt       840
     tccaccccca tccagaccgt tgccgcatgc gcgggcacca cgtaccggga attcaagcgg       900
     ctcaaccccg agttccgtgc cgaggtcatc ccttccggct gccacgaggt caaattcccc       960
     gccggatgcg gtccggcctt cgaacagaat ttcagcgcga gccgggcgtc catgtcctcc      1020
     tccgttccgg agccgtcgtc ggatgaggct ccaagggagc cggcccaggt gcgtcagcca      1080
     aaaccctcgc ccctcaaggc caagtcccga cagcccgcgg aaactttcca cacggtcagg      1140
     aaaggagaca ctctgttcag catagccagg cattacaggg tgaacgcgca ggacatcaag      1200
     aaggccaatc gtctcagggg caacgacatc gttccgggac agaagctgaa gatcccctga      1260
//

If you have problems or comments...

PBIL Back to PBIL home page