(data stored in ACNUC7421 zone)

EMBL: CP000478.PE487

CP000478.PE487       Location/Qualifiers
FT   CDS_pept        589779..590630
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sfum_0491"
FT                   /product="TonB family protein"
FT                   /note="TIGRFAM: TonB family protein; PFAM: Gram-negative
FT                   tonB protein; KEGG: pca:Pcar_0453 periplasmic protein TonB
FT                   links inner and outer membranes-like"
FT                   /db_xref="EnsemblGenomes-Gn:Sfum_0491"
FT                   /db_xref="EnsemblGenomes-Tr:ABK16191"
FT                   /db_xref="GOA:A0LFI9"
FT                   /db_xref="InterPro:IPR003538"
FT                   /db_xref="InterPro:IPR006260"
FT                   /db_xref="InterPro:IPR037682"
FT                   /db_xref="UniProtKB/TrEMBL:A0LFI9"
FT                   /protein_id="ABK16191.1"
FT                   /translation="MRLWQNLTISILGHLGVACVLWATPLAIYRPPPWMEVRLISPADF
FT                   HGRAEIPCDGNGAGEGGPAADDNIHAAPKEVCAVKQLPPPEQRPEEPKLEPPVRNRSVK
FT                   KEKPPAKPKGASRVVPLAAIRADAQRPADPAESSAGEGAAAAGSHASIGPGTFASGTPS
FT                   GGSVDAGAGAGSLSPGGPGEGVVDARFGAANGPRFHRLVKPRYPSVARQLGKEGTVVLR
FT                   VTIDEKGRAIHVEVLTRAGSGFEEEAILAVRESTFTPARLNGHAVKSRAVLPIRFALTN
FT                   SG"
     atgcggcttt ggcagaacct caccatatcc atcctgggtc atctcggcgt tgcgtgcgtc        60
     ctttgggcca cgccgcttgc gatctaccgg ccgccgcctt ggatggaggt ccggctcata       120
     tccccggcgg atttccacgg ccgggcggaa atcccctgtg acgggaacgg agccggggaa       180
     ggcggccccg ctgcggacga caacatccat gccgcaccga aagaggtttg cgcggtaaag       240
     caattgcccc ctcccgaaca gcggcccgag gagccgaaac ttgaaccgcc cgttcggaac       300
     cggtccgtaa agaaagaaaa acccccggca aaaccgaagg gtgcttcccg ggtggttccg       360
     ctcgcggcta tccgcgccga cgcacaacgg ccggcggacc ctgcggaatc ctccgcggga       420
     gaaggtgcgg cggcagcggg atcgcacgcc tccatcgggc ccggcacctt tgcttcgggg       480
     actccgtccg gtggttccgt ggatgcgggc gcgggcgcgg ggtccctcag cccgggagga       540
     ccgggcgaag gggtggtgga cgcccggttc ggagccgcaa acggtcccag gttccatcgc       600
     ctggtgaaac cgaggtaccc cagtgttgcg cggcaactgg ggaaggaggg cacggttgtg       660
     ctgcgggtga cgatcgatga aaaggggcgc gcgatccacg ttgaagtctt gacgcgggcg       720
     ggctccggtt tcgaggagga ggcgatcctg gcggtgaggg aatccacttt cactccggcc       780
     aggttgaacg gacacgccgt caagtcgagg gctgtgctcc ccatccggtt cgctctcacg       840
     aattcggggt ag                                                           852
//

If you have problems or comments...

PBIL Back to PBIL home page