(data stored in ACNUC7421 zone)

EMBL: CP000478.PE488

CP000478.PE488       Location/Qualifiers
FT   CDS_pept        591607..593895
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sfum_0492"
FT                   /product="TonB-dependent receptor"
FT                   /note="PFAM: TonB-dependent receptor; TonB-dependent
FT                   receptor, plug; KEGG: dar:Daro_4029 TonB-dependent
FT                   receptor"
FT                   /db_xref="EnsemblGenomes-Gn:Sfum_0492"
FT                   /db_xref="EnsemblGenomes-Tr:ABK16192"
FT                   /db_xref="GOA:A0LFJ0"
FT                   /db_xref="InterPro:IPR000531"
FT                   /db_xref="InterPro:IPR012910"
FT                   /db_xref="InterPro:IPR037066"
FT                   /db_xref="InterPro:IPR039426"
FT                   /db_xref="UniProtKB/TrEMBL:A0LFJ0"
FT                   /protein_id="ABK16192.1"
FT                   /translation="MFLLLLPGLLLPAVAVAADAAEKVAPAESRTGSSEIGYTAAEGAP
FT                   APGHADETAKKDHPLDPIVVTATRTEKSIVDVPAATSVVTREDIESRNIQKVDEAMNLV
FT                   PGLFDKRAKGLDTTGRVTLRGLPDQKRTLVLLDGQPLNNGYTGHVDWNSINPEDVQQIE
FT                   VARGPFSSLYGGNAMGGVVNIITRMPEKREFTVKGGYGSDNYWSTYGSYGDKLFDRLRL
FT                   LASFGYKSSDGYPSGLVVKKPSGSGGTPARGAVPTTDTYGNPAFIIGDTGDNSWWTQSG
FT                   GLKLSYDVCEEAKVFFSYRNNQYGYGYDNPNSYLTNAMGDTIWSGPVNFRGNTLSFTEG
FT                   SFLSGGGGILQNLYNGGLETRLFGDSVLKLSGGLIDMPTNWYVTPSSSTATRSGGPGTI
FT                   SETPTRAYHADAQLSIPVLEKHMLIVGTAFRHDEANNQEHALTDWTDTGSKADLTYEAK
FT                   GADNIFSFYSQAEIALFRDVTLYAGLRGDYWETFDGMADQVGVAGYPQYYDSKGEFSVN
FT                   PKGSVVYKPLDGTTFRASVGTAFRPPNVYELYRTWVTSYGTVYQGNPKLDPESSFSWDI
FT                   GVEQKIGQSTVLKLTYFNNTIDDFIYFRTVTPTLLVQTNAGKAETDGFELEAETRPWEC
FT                   LKLFTSFTYTHSEMLDNPANPLTEGKQLPGVPRYMFSAGGEVKYRRLSFTAIGRYVSKQ
FT                   YSSDQNLDTVSGVYGSYDAYFVGEFAARYKLTDWATIDFAVNNIFDNNYYSYYKAPGRQ
FT                   FFGGVTARF"
     atgttcctgt tgttgctgcc cggccttctc ctgccggcgg tcgcggttgc tgcggacgcc        60
     gcggaaaagg tcgcgccggc ggaatcccgg accgggagtt ccgaaatcgg ttacaccgcc       120
     gccgaaggcg ctccagcacc aggccatgcc gatgagacgg caaaaaagga ccatccgctc       180
     gatcccatcg tggtgacggc gactcggacg gaaaaatcca tcgtggacgt gccggccgcc       240
     acttcggtcg tcaccaggga agacatcgaa agccggaaca tccagaaggt ggacgaggcc       300
     atgaacctgg tccccgggtt gttcgacaag cgcgccaagg ggctcgacac cacgggccgg       360
     gtgacgttgc gggggctgcc ggaccagaag agaaccctcg tcctgctgga cggccagccg       420
     ttgaacaacg gctatacggg tcatgtggac tggaattcga tcaacccgga agacgtgcag       480
     cagatcgaag tcgcccgcgg gccgttttct tccctctacg gcggaaacgc catgggcggc       540
     gtggtcaaca tcatcacccg catgcccgag aagcgggaat tcaccgtaaa aggcgggtac       600
     ggcagcgaca attactggag cacctacgga tcgtacggcg acaaactgtt cgaccgtctg       660
     aggctgctcg ccagcttcgg atacaagtcg agcgacgggt accccagcgg ccttgtcgtg       720
     aaaaaaccga gcggatcggg agggacccca gccaggggag ccgttcccac gacggacact       780
     tacgggaacc cggccttcat catcggcgat acgggcgaca acagctggtg gacgcagtcc       840
     ggcgggctca agctttccta cgacgtctgt gaggaggcga aggtattctt ttcataccga       900
     aacaaccagt acggctacgg gtacgacaat cccaacagtt atctgacgaa cgccatgggg       960
     gataccatct ggtccggccc cgtcaacttc aggggcaata cgctgagctt caccgaaggg      1020
     tcttttctca gcggcggagg cggcattctc cagaatctat ataacggcgg cctcgaaacc      1080
     cgcctcttcg gggattccgt gctcaagctc tccggggggc tcatcgacat gccgacaaac      1140
     tggtatgtca ctccatcgtc gtcaaccgcc acccggtccg gcgggcccgg cacgatcagc      1200
     gaaaccccca ctcgcgccta ccacgcggac gcacagctgt ccattcccgt gctcgaaaag      1260
     cacatgctca tcgtggggac cgccttccgc cacgacgagg ccaacaacca ggaacacgcc      1320
     ctgaccgact ggaccgacac cgggtccaag gcggacctga cttatgaagc caagggagcg      1380
     gacaatatct tttccttcta ttcgcaagcc gaaatagcgc tcttcaggga cgtcaccctc      1440
     tacgccgggc tgcgcggcga ctactgggaa accttcgacg gcatggccga ccaggtcggc      1500
     gtcgcgggct atccccagta ttacgattca aaaggggagt tttcggtcaa tcccaagggc      1560
     tccgtcgtct acaagccctt ggacgggacg acgttcaggg cgtccgtcgg gacggcattc      1620
     cggcccccca acgtgtacga gctgtatcga acatgggtca ccagctacgg cacggtctac      1680
     cagggcaacc cgaaactcga tcccgagagc agtttctcgt gggatatcgg ggtggagcag      1740
     aaaatcggac agagcaccgt gctgaagctc acctatttca acaacaccat cgatgacttc      1800
     atctacttca gaaccgtgac ccccacgctt ctcgtccaga cgaacgccgg aaaggccgaa      1860
     accgacggtt tcgagctgga agcggaaacc aggccgtggg aatgcctgaa gctcttcacc      1920
     agtttcacgt acactcacag cgagatgctg gacaatcccg cgaatccgct cacggaaggc      1980
     aagcagctcc ccggggtccc ccggtacatg ttcagcgccg ggggcgaggt aaaataccgc      2040
     aggctttctt tcaccgccat cgggcgctac gtcagcaagc agtacagcag cgatcagaac      2100
     ctggacaccg tctccggggt gtacggttcc tacgatgcgt atttcgtggg cgaatttgcg      2160
     gcgagataca agctgacgga ttgggcgacg atcgatttcg cggtgaacaa catcttcgac      2220
     aacaactact acagctacta caaagccccc gggaggcagt tcttcggggg ggtgacggcg      2280
     agattctga                                                              2289
//

If you have problems or comments...

PBIL Back to PBIL home page