(data stored in ACNUC7421 zone)

EMBL: CP000478.PE489

CP000478.PE489       Location/Qualifiers
FT   CDS_pept        593895..594866
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sfum_0493"
FT                   /product="periplasmic binding protein"
FT                   /note="PFAM: periplasmic binding protein; KEGG:
FT                   hac:Hac_1669 iron(III) ABC transporter, periplasmic
FT                   iron-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sfum_0493"
FT                   /db_xref="EnsemblGenomes-Tr:ABK16193"
FT                   /db_xref="InterPro:IPR002491"
FT                   /db_xref="UniProtKB/TrEMBL:A0LFJ1"
FT                   /protein_id="ABK16193.1"
FT                   /translation="MAAILVWFQLVLFVAAGAAPALAHALTLKDAAGKDVEIALPVRRV
FT                   VFLSLYDLIPVFGIWDRAAGINRWAFDSAVLKGFPELKACTSVGTGDSVNVETLLSLHP
FT                   DLVITWSYKPEVTAFLVERGLKVISVWPESLRELYQVIDLYGRIFQKEDRAREVRSLME
FT                   NSLAATASKVSKVAPEKRPKVLWVWTKPTTVSGGIGLQQDLIRLIGAVNPAEHIPSKQA
FT                   DVSLEWIVAWDPDVIFIWGSARYGPGDLASNRQWKSVKAVRNGRVYKAPALSTWSPAVS
FT                   TLALWMAYKAHPGCFDSREALEAIREFHMKCFGVPLEGLALD"
     atggcggcaa ttctggtctg gtttcaactt gtcctgttcg tggcggccgg cgccgcgccg        60
     gcgttggccc acgcgctcac cctgaaggac gcggcgggaa aggacgtcga gatcgcgctc       120
     cccgtgagaa gggtcgtctt tctctcgctc tacgatctca tcccggtgtt cggcatatgg       180
     gaccgcgcgg cgggaataaa ccggtgggcg ttcgacagcg cggtgctcaa ggggttcccc       240
     gagcttaagg catgcacctc cgtgggcact ggggattcgg tgaacgtcga gaccctcctg       300
     tccctgcacc ctgacctggt gatcacctgg tcctacaagc cggaggtcac ggctttcctt       360
     gtcgaaagag ggctcaaggt catctccgtg tggccggaaa gtctccgcga gctctaccag       420
     gtgatcgatc tgtacgggag aatcttccag aaggaggacc gggcacgcga ggttcggtcc       480
     ttgatggaaa acagcctggc ggccacggca tcgaaagtgt cgaaggtcgc gccggagaaa       540
     cgtccgaagg tgctgtgggt ctggacgaag cccacaacgg tcagcggcgg gatcggcctc       600
     cagcaggatc tcattcgcct gatcggggcg gtcaaccccg cggaacacat accgtcgaag       660
     caggcggacg tttcgctgga atggatcgtt gcgtgggacc ccgatgtgat cttcatctgg       720
     gggagcgctc ggtacggtcc cggggatctc gcgtcgaacc ggcagtggaa gtccgtcaaa       780
     gcggtcagga acgggcgcgt ttacaaggcc cccgccttgt ccacctggtc gcccgccgtc       840
     agcacgctcg cgctctggat ggcttacaag gcgcatcccg gatgcttcga tagtagggaa       900
     gccctggagg cgatccggga gtttcacatg aaatgtttcg gggttccgct ggaaggactg       960
     gctctcgact ag                                                           972
//

If you have problems or comments...

PBIL Back to PBIL home page