(data stored in ACNUC7421 zone)

EMBL: CP000478.PE49

CP000478.PE49        Location/Qualifiers
FT   CDS_pept        complement(66160..66795)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sfum_0050"
FT                   /product="Lytic transglycosylase, catalytic"
FT                   /note="PFAM: Lytic transglycosylase, catalytic; KEGG:
FT                   gsu:GSU1826 lytic murein transglycosylase, putative"
FT                   /db_xref="EnsemblGenomes-Gn:Sfum_0050"
FT                   /db_xref="EnsemblGenomes-Tr:ABK15753"
FT                   /db_xref="GOA:A0LEA1"
FT                   /db_xref="InterPro:IPR000189"
FT                   /db_xref="InterPro:IPR008258"
FT                   /db_xref="InterPro:IPR023346"
FT                   /db_xref="InterPro:IPR025392"
FT                   /db_xref="UniProtKB/TrEMBL:A0LEA1"
FT                   /protein_id="ABK15753.1"
FT                   /translation="MKHPTRLGVASIATAWGMICLLLLFQSHARADIYKYVDKDGVIHF
FT                   TNTPVQPEAKSLTLPPVTQANFVKYFPHRTFYSACNPKNQNYFDPQIRMVCMRHGLDYN
FT                   LVRAVIRAESGYNPQAVSPKGAMGLMQLMPGTSRDLGVLNPFDPGENIDGGARYLKMLI
FT                   ERFNNIPLAVAAYNAGPENVEKYKGIPPFDETQVYVQRVMDYYSRYRQ"
     atgaagcatc cgacaagact aggtgtggcc tccatagcaa ccgcctgggg tatgatttgc        60
     ctgttgcttc tctttcaatc tcatgcgcgg gcggacattt acaagtacgt ggacaaggac       120
     ggcgtgatcc actttaccaa tacgcccgtg caaccggagg ccaaatcgct gaccctgcct       180
     ccggttacgc aggcgaactt cgtcaagtat tttccgcacc gtacgttcta ctccgcctgt       240
     aaccccaaga atcagaatta cttcgacccg cagatcagga tggtttgcat gcggcacgga       300
     ctggactaca acctcgtgcg ggccgtgatc agggccgaat ccgggtacaa tccacaggcg       360
     gtttccccca agggtgccat gggcctgatg cagctgatgc ccggcacatc cagggatctg       420
     ggagtgctca accccttcga tcccggcgag aacatcgacg ggggagcccg ctacctcaaa       480
     atgctcatcg agcggttcaa caacatcccc ctggctgtcg ccgcctacaa tgccggtccc       540
     gaaaatgtcg agaagtacaa gggaattcca cccttcgatg aaacgcaggt ttacgtacag       600
     cgtgtgatgg attactattc ccgctataga caatga                                 636
//

If you have problems or comments...

PBIL Back to PBIL home page