(data stored in ACNUC7421 zone)

EMBL: CP000478.PE492

CP000478.PE492       Location/Qualifiers
FT   CDS_pept        596686..600498
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sfum_0496"
FT                   /product="hydrogenobyrinic acid a,c-diamide
FT                   cobaltochelatase"
FT                   /EC_number="6.6.1.2"
FT                   /note="PFAM: CobN/magnesium chelatase; KEGG: mac:MA0872
FT                   cobN/magnesium chelatase family protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sfum_0496"
FT                   /db_xref="EnsemblGenomes-Tr:ABK16196"
FT                   /db_xref="GOA:A0LFJ4"
FT                   /db_xref="InterPro:IPR003672"
FT                   /db_xref="UniProtKB/TrEMBL:A0LFJ4"
FT                   /protein_id="ABK16196.1"
FT                   /translation="MKLLSIMWSNYVPLLKQAAAETGTFDLRAYSNKQLNLDPLKLREC
FT                   RKEVKSADLILFYRTTESFWDELEDELKDCRGRIPVVTVGPDIASWKLSNVNPEIVANV
FT                   YRYLLFNGGDNFREMLKYLAAAVFSIEIPYDPPKETAWEGIFHPQWGGPFDTTREYLEI
FT                   YPHKDRPLVGVLFSRSNWVSGNLEVESRTIAAIEEQGLGVLPVFFYSVKDTNLGNLGGE
FT                   DVVRGFLLAEDGSPLVEAVVKLTVFFLGQKKGNSSESQAESGVGLLKALNVPLVNPVIS
FT                   YYKDRTQWLDDPAGLGQQVAWSIALPEFEGVVEPLVVGASKGVSNPEEEMYEAIPDRID
FT                   RLARRISRWVRLRRTPNRLKKIAFILHNNPCASVEATVGGGAHLDTLESVARVLRRMKD
FT                   EGYAVTPPENGKALIDEILERKAISEFRWTTTGEIAARGGCLAQLDVAGYSRWFDELPE
FT                   ATRNRMIEAWGRPPGEEKDGVPAAMVHEGKILVTGVRYGNAVVCVQPKRGCAGARCDGQ
FT                   VCRILHDPNVPPPHQYVATYKWLSRDFGADAIVHVGTHGNLEFLPGKGTGLSSGCFPDI
FT                   GIDEMPNLYIYNADNPPEGTTAKRRSCAVLVDHMQAVMVRGELYGDLDELERLMSEYDK
FT                   IKLVEPGKAHTLRHMIEARLEAGNLLQGMKIDHDAPFDEVLKAAHEALSLLKNTYIPKG
FT                   MHVFGSIPEGERLSEFIYAVVRYENTPESLRGVVKSLMERDEGFRALDETAGKNLVDEK
FT                   AQAICTAYLEGEAPLAHIMQSHFDDISRFESAIACVQEKIDDVRKRVALTDEMSALLNG
FT                   AAGGYVPPGPSGIVTRGRPDILPTGRNFYSLDPHKVPSRAGWEVGVQLAGLTIEKFLNE
FT                   EGKYPENIAFYWQCTDIMWSDGEGMAQMMYLLGVRPVWQANGKVSGFEIIPLEELKRPR
FT                   IDITVRVSGITRDNFASVIELIDEAVQAVAALDEPPDRNFVRRHLLAHMEESGAAEDEA
FT                   EAFRKGTFRLFSSMPGVYQAGTQLAVYASAWKDEKDLCDVFLYWNGYAYGKGVFGEPAH
FT                   RHLSRSLETVELTFAKTVTDEYDLLGCCCHFGTHGGLINAAKVVSGRDIKTYYGDTREM
FT                   GEVRVRDLADEIRRIVRTKLLNPKWIEGMKEHGYKGAGEIGKRVGRVYGWEATSREVDD
FT                   WIFDDIARTFLMDEGNRKFFEENNPYALEETARRLIEAAERGLWAPSADVRDALKEIYV
FT                   EIEGWIEEKTGEMEGDFQGGSIDIITSREVESWKGKMDETLGRKG"
     atgaagctcc tgtccatcat gtggtcgaat tatgttccgc tcctcaagca ggccgccgcc        60
     gagaccggaa cgttcgatct cagggcgtac tcgaacaagc agctgaacct cgaccctcta       120
     aaactgcggg aatgcaggaa ggaagtcaaa agcgccgacc tgatcctgtt ctacaggacg       180
     accgagtcgt tctgggacga actggaagat gagctgaagg attgtcgcgg tcggattccg       240
     gttgtgacgg tggggccgga catcgcctcc tggaagctct ccaacgtgaa tcccgaaatc       300
     gttgcgaacg tgtaccgcta cctcctgttc aatggcgggg acaatttcag ggagatgctg       360
     aagtacctcg cggcggcggt tttttccatc gagattcctt atgacccccc gaaagagacg       420
     gcatgggaag ggattttcca cccgcaatgg ggcggacctt tcgataccac ccgggaatac       480
     cttgaaatct atccccacaa ggaccggccg ctcgtgggcg tgctcttctc ccgttccaat       540
     tgggtgtccg ggaacctgga ggtggaaagt cggaccatcg ccgccatcga ggagcagggc       600
     ctgggcgtgc tgcccgtgtt cttctattcc gtcaaggaca ccaacctggg caacctgggg       660
     ggcgaggacg tggtgcgcgg gttcctcctg gcggaagacg gcagccctct cgtcgaggcg       720
     gtcgtgaaac tcacggtttt cttcctcggg cagaaaaagg ggaattcatc cgagtcgcag       780
     gcggaatccg gcgtcggtct gctcaaagcc ttgaatgttc ccctcgtgaa ccccgtcatc       840
     tcctactaca aggaccggac gcaatggctt gacgacccgg cgggcctcgg gcagcaggtc       900
     gcctggagca tcgcgctccc ggagttcgag ggggttgtcg aaccgctcgt ggtgggtgcg       960
     agcaaagggg tgagcaatcc ggaggaggaa atgtacgaag ccattccgga ccggatcgac      1020
     cgcctggccc gccggatttc caggtgggtc cggttgcggc gcacacccaa ccgcctgaaa      1080
     aagatcgcct tcatccttca caacaatccg tgcgcctccg ttgaagccac ggtcggcggt      1140
     ggagcgcacc tggataccct ggagagcgtt gcccgggtcc tgcgtcgaat gaaggatgag      1200
     ggatacgcgg tgactcctcc ggaaaacggg aaggccctca tcgatgaaat cctcgaacga      1260
     aaggcgattt ccgagttccg gtggaccacg accggggaaa ttgcggcgcg cggaggctgc      1320
     ctggcgcaac tcgacgtcgc gggctattcg cgctggttcg atgaattgcc cgaagcgacc      1380
     cgcaacagaa tgatcgaagc atgggggcgc ccgcccggcg aggaaaagga cggcgtgccg      1440
     gcggcgatgg tccacgaagg gaaaatcctt gtcacggggg tgcggtacgg caacgccgtg      1500
     gtctgtgtcc agccgaagag gggctgcgcg ggagcgcggt gcgacgggca ggtctgcagg      1560
     attctgcacg atccgaatgt gccgccgccg caccagtacg tggccaccta caagtggctt      1620
     tcgcgggatt tcggcgcgga tgcgatcgtt catgtcggaa cgcacgggaa tctcgaattc      1680
     ctgcccggga agggcacggg gctgtccagc ggctgctttc cggatatcgg catcgacgag      1740
     atgccgaatc tctacatcta caacgcggac aacccacccg aggggaccac ggcgaaacgc      1800
     cggagctgtg ccgtgctggt ggatcacatg caggcggtga tggtccgggg ggagctttac      1860
     ggggacctgg acgagctcga acggctcatg tccgaatacg acaaaatcaa gcttgtcgaa      1920
     ccgggcaagg cccacacgct tcgacacatg atcgaggcgc ggctcgaagc cgggaacctg      1980
     ctgcagggga tgaagatcga ccatgacgcg cccttcgatg aagtattgaa ggcggcgcac      2040
     gaggcgctct cgctgctcaa aaacacttat atccccaaag gcatgcacgt gttcggaagc      2100
     atccccgagg gcgagaggct gtccgaattc atttacgcgg tcgtgaggta cgagaacacc      2160
     cccgaatcgc tgcgtggggt tgtgaaaagc ctgatggaaa gggacgaggg gttccgggcg      2220
     ctcgatgaga cggccggcaa aaacctcgtg gatgaaaaag cgcaagcgat ctgcacggcc      2280
     taccttgagg gagaagcgcc ccttgcgcac atcatgcaat cgcacttcga cgatatctcc      2340
     cggttcgaat ccgcgatcgc ctgcgtacag gagaagatcg acgacgttcg aaaacgggtg      2400
     gcgctcaccg acgagatgtc ggcgcttctg aacggagcgg cgggcggata tgttccgccc      2460
     gggccgtccg ggatcgtcac gcggggcagg ccggatatcc tccccacggg acgcaacttc      2520
     tactcgcttg atcctcacaa ggtgccgtcc cgtgcaggtt gggaagtggg ggtgcaactc      2580
     gcgggcctga cgatcgaaaa attcctgaac gaggagggga agtaccccga gaacatcgct      2640
     ttctattggc agtgcacgga catcatgtgg tccgacggcg aaggaatggc ccagatgatg      2700
     tacctgctcg gcgtacggcc cgtgtggcag gcaaacggaa aagtgtcggg atttgaaatc      2760
     attcccctgg aagagctgaa acgccccagg atcgatatca cggtgcgggt gtccggcatc      2820
     acgcgggaca atttcgcgtc cgtcatcgag ctgatcgacg aggcggtgca ggccgtggcc      2880
     gcgctcgatg aaccgccgga ccggaatttc gttcgcaggc atctcctggc gcacatggag      2940
     gagagcgggg cggccgagga tgaagccgag gcgttccgaa aagggacctt tcggctgttc      3000
     tcgagcatgc ccggggtcta ccaggcgggg acccagcttg ccgtgtacgc gtccgcctgg      3060
     aaggacgaaa aggatctctg cgacgtgttt ctttactgga acgggtacgc ttacggcaag      3120
     ggagtgttcg gcgagcccgc tcaccggcat ttgtccagga gcctcgaaac ggtcgaactg      3180
     acttttgcca agacggtcac cgacgaatac gaccttctcg gatgctgctg ccatttcggc      3240
     actcacggag ggctcatcaa cgccgcaaaa gtcgtttcgg gcagggacat caagacatac      3300
     tacggcgaca cgagggaaat gggcgaggtc cgggtcaggg atcttgccga cgaaatccgc      3360
     aggatcgtga ggacgaagct gctcaacccg aaatggatcg aaggaatgaa ggaacacggc      3420
     tacaagggcg cgggagagat cggcaagcgg gtgggcaggg tctacggatg ggaagccacg      3480
     agcagggaag tggatgactg gatcttcgac gacattgccc gaaccttcct catggacgag      3540
     gggaatcgga agttcttcga ggagaacaac ccgtacgccc tcgaggagac cgcccgaaga      3600
     ctgatcgagg cggccgaacg ggggctttgg gctccgtccg ccgacgtgcg ggacgcgctc      3660
     aaggaaatct atgtcgagat cgagggatgg atcgaggaaa agaccggaga aatggaaggc      3720
     gactttcaag gcggctcgat cgacatcatc acttcacgcg aagtggaaag ttggaagggg      3780
     aaaatggatg agactctggg acgaaagggt tag                                   3813
//

If you have problems or comments...

PBIL Back to PBIL home page