(data stored in ACNUC7421 zone)

EMBL: CP000478.PE493

CP000478.PE493       Location/Qualifiers
FT   CDS_pept        600502..601542
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sfum_0497"
FT                   /product="protoporphyrin IX magnesium-chelatase"
FT                   /EC_number="6.6.1.1"
FT                   /note="SMART: AAA ATPase; KEGG: mja:MJ0911
FT                   magnesium-chelatase subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Sfum_0497"
FT                   /db_xref="EnsemblGenomes-Tr:ABK16197"
FT                   /db_xref="GOA:A0LFJ5"
FT                   /db_xref="InterPro:IPR000523"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR041628"
FT                   /db_xref="UniProtKB/TrEMBL:A0LFJ5"
FT                   /protein_id="ABK16197.1"
FT                   /translation="MIFPFTAIVGQDQMKLGLILNVIDPTIGGLLIMGEKGTGKSTAVR
FT                   ALADLLPEIAVSRGCAFNCDPDGKNLCTSCVEKASPGRPLESETRKMKVIELPLGITED
FT                   RLVGTLDIEHALKHGAKRFEPGILADANRNFLYVDEVNLLEDHIIDLLLDSAAMGRNFV
FT                   EREGVSFTHPARFILVGTMNPEEGDLRPQLLDRFGLCVYVRSIREREPRMEILRRRFEF
FT                   DADPAAFLEKIEPDQRSLSERIVRARRNLQDIKMPDEILEKVVGVTSAVHVDGHRSDIV
FT                   ILRGARALAALKGRERIEMEDIKDIVRPALNHRLKRAPFEEIGSGASKMEAVIEQLGRS
FT                   DGAAIS"
     atgatttttc ctttcacggc cattgtcggt caggatcaga tgaagctggg tcttattctc        60
     aacgtcatag accccaccat cggggggctc ctcatcatgg gcgagaaagg gacggggaaa       120
     agcaccgcgg tgcgggccct cgcggatctc cttcccgaaa tcgccgtttc caggggctgc       180
     gcgttcaatt gcgatcccga cggcaaaaac ctgtgcacgt cctgcgtgga aaaagcgtcg       240
     ccggggcgcc ctctggagag cgagacgaga aagatgaaag tgatcgagct ccctctcggc       300
     atcacggagg acaggctcgt cggaacgctc gatatcgagc atgccctcaa acacggggca       360
     aagcgattcg aaccggggat tctcgcggat gcaaaccgaa actttcttta tgtggacgaa       420
     gtcaacctgc tcgaagacca catcatcgat ttgttgctcg attccgcggc catggggcgg       480
     aatttcgtcg agcgggaagg agtttccttc acgcatcccg cccgcttcat cctcgtgggc       540
     acgatgaatc ccgaggaagg cgacctcagg ccccagcttc tggaccgttt cggtctctgt       600
     gtctacgtac ggtccattcg agaaagggag ccgcgcatgg aaatcctcag gagacgcttc       660
     gagttcgatg cggatcccgc tgcttttctc gagaaaatcg agcccgacca gcgatccttg       720
     tcggagcgga tcgtccgggc caggcgaaac cttcaggaca tcaagatgcc ggacgaaatc       780
     ctggaaaagg tggtcggggt cacctcggcg gttcatgtgg acggccaccg ctcggacatc       840
     gtgattctca gaggggcgag agcgctcgcc gccttgaagg ggcgggagcg catcgaaatg       900
     gaagatatca aggatatcgt tcgcccggca ctgaaccaca ggctcaagcg ggccccgttc       960
     gaagagatcg gatcgggggc aagcaaaatg gaagcggtga tcgagcagtt gggccgaagt      1020
     gacggcgctg cgatttcgta a                                                1041
//

If you have problems or comments...

PBIL Back to PBIL home page