(data stored in ACNUC7421 zone)

EMBL: CP000478.PE495

CP000478.PE495       Location/Qualifiers
FT   CDS_pept        603884..604267
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sfum_0499"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sfum_0499"
FT                   /db_xref="EnsemblGenomes-Tr:ABK16199"
FT                   /db_xref="UniProtKB/TrEMBL:A0LFJ7"
FT                   /protein_id="ABK16199.1"
FT                   /translation="MPTIVQPGIPAPGRNRSVAMARFWAHLKRHNPAMRIKSRQNPALS
FT                   GHKVWRDSREDANRLGKSKDRAHAKSSLTQRRDDGRRSAHTFAKRKGAGDSGACPLPFR
FT                   TCMKTPDKGVTPTSGLQLEIDPA"
     atgccaacca ttgttcagcc tggaattccc gctccgggac ggaatcgatc ggtcgccatg        60
     gcgcgatttt gggctcattt aaagcgccat aatcccgcca tgcgcattaa atcccgccaa       120
     aatcccgcac tttcgggcca taaagtatgg cgcgattctc gcgaggatgc gaatcgcctc       180
     gggaaaagca aggaccgggc tcacgcaaag agcagcctca cgcaacggcg cgacgacggg       240
     cgccgttcgg ctcatacctt cgcgaaaagg aagggggcag gcgattcggg cgcctgcccc       300
     cttccttttc ggacatgcat gaaaacgccc gacaaaggtg taactccgac ttccggtctc       360
     cagctcgaaa tcgatcccgc ctga                                              384
//

If you have problems or comments...

PBIL Back to PBIL home page