(data stored in ACNUC7421 zone)

EMBL: CP000478.PE499

CP000478.PE499       Location/Qualifiers
FT   CDS_pept        608391..609416
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sfum_0503"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: ddi:DDB0188529 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sfum_0503"
FT                   /db_xref="EnsemblGenomes-Tr:ABK16203"
FT                   /db_xref="UniProtKB/TrEMBL:A0LFK1"
FT                   /protein_id="ABK16203.1"
FT                   /translation="MKKTLFALVALAVIVVGCGEPALAKGGGKGGGKGAGGAAAPRAAK
FT                   YRPPQPAVSLGSAGFASQYGPVTSYYGSLASQYGSLLSQYGPSIGQTGSSPLQGTSTTG
FT                   TGQGTPIFGQSDVFASTTPGAIPGAPDILSGLSMGLDSGLADLILSGLQGTATAGRPSS
FT                   SRFQLPTAVQILPPTTPGSAAVGQYTYDLSLALAAPQLTSISAFPGQYGTLPLQTGMAA
FT                   LSYGPQAGAYGFVPVTGALGGTAGQYGYFAGQYDMTSSLQDQSTQVALSSAAVTAILDA
FT                   LSSRLRTSSGLPGSTLTGTGIGRFSGSIPGMAAPVGGMPSTLSQFQAAPGMGSPLRMGP
FT                   P"
     atgaagaaga cgctgtttgc actcgttgct cttgccgtta ttgtcgtcgg gtgcggtgag        60
     ccggccttgg ccaaaggcgg cggcaagggc ggcgggaaag gcgccggcgg cgccgccgcg       120
     ccacgggcgg caaaatatag accacctcaa cccgccgtgt cgcttggttc cgccgggttc       180
     gcaagccagt acgggccggt gacgtcttac tacggaagcc ttgccagtca gtacggaagt       240
     ctgctgagcc aatacggtcc gagtatcggt cagaccgggt cgagtccctt gcagggcact       300
     tccacgacag gcaccggtca gggaactccg atcttcggac aatccgacgt gttcgcctcc       360
     acaacgcccg gcgcgattcc gggggccccg gatatcctct cgggtctttc gatgggtttg       420
     gattcgggtt tggccgatct catcctgagc ggacttcaag ggaccgcgac ggcaggacgt       480
     ccgtcgtcga gccgcttcca gctcccgaca gccgttcaga ttctcccgcc gaccactccg       540
     ggttccgccg ccgtggggca gtacacttac gacctgtcgc ttgcactcgc ggctccccag       600
     ctgacctcga tctccgcgtt tccggggcag tatggcaccc tgccgttgca gacgggcatg       660
     gccgcgctct cctacggacc tcaagccggg gcatacggat tcgtccccgt taccggcgcc       720
     ctcggcggca cagcggggca gtacggctat ttcgccggcc agtacgacat gacgtcgagc       780
     ctgcaggatc aatccacgca ggttgctttg agctcggcgg cagtgacggc gatcctcgat       840
     gcgctgtcct ctcggctgcg gacgtcatcg ggactgccgg gaagcacttt gaccggcacg       900
     gggatcggac gtttctccgg ctcgattccc gggatggcgg cccccgtggg gggaatgccc       960
     tccaccttgt cccagttcca ggccgctccc ggcatggggt cgcctctccg catgggccca      1020
     ccgtaa                                                                 1026
//

If you have problems or comments...

PBIL Back to PBIL home page