(data stored in ACNUC7421 zone)

EMBL: CP000478.PE5

CP000478.PE5         Location/Qualifiers
FT   CDS_pept        complement(4738..6567)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sfum_0005"
FT                   /product="Tetratricopeptide TPR_2 repeat protein"
FT                   /note="PFAM: TPR repeat-containing protein; peptidase M48,
FT                   Ste24p; Tetratricopeptide TPR_4; Tetratricopeptide TPR_2
FT                   repeat protein; SMART: Tetratricopeptide domain protein;
FT                   KEGG: dps:DP0525 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sfum_0005"
FT                   /db_xref="EnsemblGenomes-Tr:ABK15709"
FT                   /db_xref="GOA:A0LE57"
FT                   /db_xref="InterPro:IPR001915"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="InterPro:IPR013026"
FT                   /db_xref="InterPro:IPR019734"
FT                   /db_xref="UniProtKB/TrEMBL:A0LE57"
FT                   /protein_id="ABK15709.1"
FT                   /translation="MYSQFLYFIIVLLLFTMQQPGSSASLSLPLTASMAAAVWGLLALA
FT                   AYRACRGMSLAASDFSQSNLAARYHRLQFRLQILALSCFAFEVYVLDVKFYFNLIPFVE
FT                   KSLSLSGLIGLALYLSHTTVIWFFSHPAYQAVFRSAIRRSAFIKTHLSFSSAILLSWLL
FT                   VAIASDLLEAFKPFPPKWTATGEYAVLAGVMVLFMFFAPGPVVRLWGCRPLLEQPLRAE
FT                   LEIFCRKHGFRVGDFMLWPLFGGEMLTAGIVGVLPRMRYILVTRGLLSILNPEELRAVV
FT                   AHEMGHVRRFHLPMFLLFLLSYLPVAGVVSTLFLFVLLDQDIVLEWVLSAGAGAPERIS
FT                   IISSVLIVLLFLVFFRFIFGYFLRNCERQADLYAMNLMGDPYPLITSLQKIALHSGRIE
FT                   DLPSWHHYSIRQRIECLIDSSRDTTLIRRHNRKLYASALAFFVSVAVVFTTVTGLLNSS
FT                   GMRKWTFNPDRDSVERALREEPGNPDLLASYGGLLLEAGRIGEAERLLRKALHLSPDDP
FT                   SLMNNLAWLYATSPPPHHNPEAALKLAAKAAELRSDAVILDTLAEAYYVNGRYREAVDT
FT                   IEKALRQAQSDHSEYLTHKEKYQKALAAESDRS"
     atgtacagcc agtttctgta cttcatcata gtcctgctgc ttttcacgat gcagcaaccg        60
     ggctcctcgg cctcgctgtc cctgccgctc accgcatcga tggccgccgc cgtctgggga       120
     ctgctggcgt tggcggccta ccgtgcgtgc cggggaatga gtcttgccgc atccgatttt       180
     tcgcagtcaa atcttgcggc ccgttaccac aggctgcaat tccggctgca aatccttgcg       240
     ctgtcctgct ttgccttcga agtttacgtt ctggacgtca agttctattt caacctgatt       300
     ccattcgtcg aaaaatctct ttccctctcg ggtctcatcg gactggccct gtatctctcg       360
     cacacgacgg tgatctggtt tttcagccat ccggcctatc aggccgtctt ccgatccgcc       420
     atacgtcgct cggcgttcat aaagacgcat ctttccttca gttccgcgat ccttttgtcg       480
     tggctgctgg tcgcgatcgc ttccgacctg ctggaggcgt tcaaaccgtt ccctcccaaa       540
     tggaccgcga ccggagaata tgccgttctg gccggggtca tggttttgtt catgttcttc       600
     gctccgggcc cggtggtccg tctgtgggga tgtcggccgc tgctcgagca gcctttgcgc       660
     gccgaactgg aaatcttctg ccgaaaacac gggttccgcg tcggcgactt catgctctgg       720
     cccctcttcg gaggcgagat gctcacggcc gggatcgtgg gcgtcctgcc ccgcatgcgc       780
     tatatcctgg tgacccgcgg acttctgtcc atcctcaatc ccgaagagct cagagccgtg       840
     gtcgcccatg aaatgggaca cgtacgacgt ttccatctgc ccatgttttt gctgtttctt       900
     ctgtcctacc tgcccgttgc gggtgtcgtg agcacccttt tcctgttcgt tctgctcgat       960
     caggacattg tcctcgaatg ggtgctctcg gccggtgcag gcgcgcccga acgcatctcg      1020
     atcatctcga gcgtattgat cgtattgctc ttcctcgtgt ttttccgctt catcttcggc      1080
     tatttcctcc gcaactgcga acgccaggcc gatctttacg cgatgaacct gatgggagat      1140
     ccttaccccc tgatcacctc gctgcagaag atcgcgctgc acagcggccg gatcgaagac      1200
     ctgccaagct ggcaccatta cagcatccgg cagcgcatcg agtgcctgat cgattcctcc      1260
     cgcgatacga cgctcatacg tcggcacaac cgaaaactct atgcctcggc gctcgccttc      1320
     ttcgtctcgg tcgcggttgt cttcacgacc gtcaccggcc tgttgaattc atccggcatg      1380
     aggaagtgga ccttcaatcc ggaccgagac agcgtcgaac gggcacttcg ggaggagccc      1440
     gggaaccccg accttctggc ctcatacggc gggctgctcc tcgaagccgg caggatcggc      1500
     gaagcggagc ggctgctccg gaaggccctg cacctctcgc cggacgatcc ttccctcatg      1560
     aacaacctcg cttggctcta tgcgacctcc ccgcctccgc accacaatcc cgaagccgcc      1620
     ctcaaactcg ccgccaaagc ggctgaattg aggtccgacg ccgtaattct ggacaccctg      1680
     gcagaggcct attatgtgaa cgggcgttac agggaagcgg tggataccat cgagaaagcg      1740
     cttcggcagg cccaatcgga ccattccgag tatctgaccc acaaagaaaa ataccagaag      1800
     gccctggcgg cggagtcgga cagatcctga                                       1830
//

If you have problems or comments...

PBIL Back to PBIL home page