(data stored in ACNUC7421 zone)

EMBL: CP000478.PE502

CP000478.PE502       Location/Qualifiers
FT   CDS_pept        complement(611847..612143)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sfum_0506"
FT                   /product="putative protein-S-isoprenylcysteine
FT                   methyltransferase-like"
FT                   /note="KEGG: bur:Bcep18194_B2540 putative
FT                   protein-S-isoprenylcysteine methyltransferase-like"
FT                   /db_xref="EnsemblGenomes-Gn:Sfum_0506"
FT                   /db_xref="EnsemblGenomes-Tr:ABK16206"
FT                   /db_xref="InterPro:IPR007318"
FT                   /db_xref="UniProtKB/TrEMBL:A0LFK4"
FT                   /protein_id="ABK16206.1"
FT                   /translation="MLLFARLSLGRSIGFVPAQRVIVTGGAYRIVRHPIYTGIFLSFIA
FT                   WTLRDYSPRVLAISVIGCGLFVLKSFIEERFLREDPEYRDYLTRVRWRWFPGI"
     gtgctcctgt ttgcgcgcct cagcctgggg cggagcatcg gattcgttcc ggcccagcgg        60
     gttatcgtca cgggcggtgc gtaccggatt gtccgccatc cgatttatac gggcatcttc       120
     ctttccttca tcgcctggac gctgagggac tactcaccgc gggttctggc gatatcggtc       180
     atcgggtgcg gcctgttcgt tctgaaaagc ttcatcgagg aaaggttcct gcgggaggac       240
     ccggaatacc gtgactatct cacgcgggtg cgctggcgct ggtttcccgg aatatga          297
//

If you have problems or comments...

PBIL Back to PBIL home page