(data stored in ACNUC7421 zone)

EMBL: CP000478.PE504

CP000478.PE504       Location/Qualifiers
FT   CDS_pept        complement(613722..613985)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sfum_0508"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sfum_0508"
FT                   /db_xref="EnsemblGenomes-Tr:ABK16208"
FT                   /db_xref="InterPro:IPR011467"
FT                   /db_xref="UniProtKB/TrEMBL:A0LFK6"
FT                   /protein_id="ABK16208.1"
FT                   /translation="MIRSFGMKPWLIAVLLAAFLNGSGLCAVENPGPALLLCSEPQAGP
FT                   CAELLETTHDFGKITLGDVLEHEFKVGNPGNDTLVIENVRVG"
     atgatacgat cgtttggaat gaaaccgtgg cttatcgccg tgctccttgc ggcgttcctg        60
     aacggttcgg gcctgtgcgc cgtcgagaac ccgggaccgg ccctgctcct ttgctccgaa       120
     ccccaagccg ggccctgtgc cgagcttctc gagaccaccc acgacttcgg caaaatcacc       180
     ctgggcgacg tgctggaaca tgaattcaag gtgggaaatc ccgggaacga tacactggtg       240
     atcgaaaacg tccgcgtcgg atga                                              264
//

If you have problems or comments...

PBIL Back to PBIL home page