(data stored in ACNUC7421 zone)

EMBL: CP000478.PE507

CP000478.PE507       Location/Qualifiers
FT   CDS_pept        complement(617105..619048)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sfum_0511"
FT                   /product="Rhodanese domain protein"
FT                   /note="PFAM: Rhodanese domain protein; protein of unknown
FT                   function DUF395, YeeE/YedE; KEGG: ade:Adeh_2629
FT                   hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sfum_0511"
FT                   /db_xref="EnsemblGenomes-Tr:ABK16211"
FT                   /db_xref="GOA:A0LFK9"
FT                   /db_xref="InterPro:IPR001307"
FT                   /db_xref="InterPro:IPR001763"
FT                   /db_xref="InterPro:IPR007272"
FT                   /db_xref="InterPro:IPR036873"
FT                   /db_xref="UniProtKB/TrEMBL:A0LFK9"
FT                   /protein_id="ABK16211.1"
FT                   /translation="MAVSLLVGFGFGFALERAGFGSSRKLGGIFYFRDMTVLRVMFTAM
FT                   ITAMLGLHLALSLGIVASDQIYFLPTVYGAQIVGGVLFGIGFGLACWCPGTAAVGVASG
FT                   RLDALIYLFGAVLGSILFNEIYGLLEPLYTWGESGVKFVWEALGVSAPFFALVFSGLGV
FT                   AAFWFAEWIERRTAGTGPYFGSPFLKAFSVAVLAAAFGVAVLPSAGIDRAAVSRLGPPP
FT                   ETAILQTMQAGEDHVEPEALADRLMTGDPSLLLVDIRTPGEYSAFHIKGALNVAPADLP
FT                   ETLAPRRDRGTIVLYSNGMTHPAQARDALARMGFNNVTILTDGLQGFMHRVLKPVSLRE
FT                   APLTAEMAAQVEAWRGFFLGTATARADDSQGSTGGMPGLVETAWLNEHLGRGDVRIIET
FT                   RSQPAYNGGHLPGSVRMDPEHFRGVVGGVSSMVLPVDMIVRHLELLGIRPETTIVVVPS
FT                   EKIMDATLIGTALERAGHRRYAILNGGWEKWLAERRPVDTLLPAITETAYPAPREADRF
FT                   TVDYRTVLEHVHRRSAVLLDVRPADYFSGAKSDEARAGHIPGAVNRPFADDLATIDGIT
FT                   SFKPRAELEEAYARLIPSKDTTVVVSCRTGHQASQTRFVLQNILGYRKVFWYDGGWAEW
FT                   SSRPELPVETSP"
     atggcggttt cgctgctggt gggcttcggt ttcggatttg cgctcgaacg cgcgggtttc        60
     gggagctcca ggaagttggg ggggattttt tactttcggg acatgacggt gttgagagtc       120
     atgttcacgg cgatgatcac ggcgatgctc gggctgcacc tggccctgtc gctggggatc       180
     gtcgcttccg accagattta ctttcttccc accgtgtacg gcgcgcaaat cgtcggcggc       240
     gtgctgttcg gtatcgggtt cggcctggcc tgctggtgtc cgggcacggc ggccgtgggc       300
     gtggcatccg ggcgcctcga cgcgctgatt taccttttcg gggcagtcct tgggagtatc       360
     ctgttcaacg agatctacgg cctgctggaa cccctgtaca cgtggggcga gagcggagtg       420
     aaattcgtct gggaggctct gggcgtgtcc gctccgtttt ttgccctggt cttttcgggc       480
     ctcggcgtgg ccgcgttctg gttcgcggaa tggatcgaga ggcgaaccgc cggtacgggt       540
     ccctattttg gcagtccctt cctcaaagct ttcagcgtgg ccgtcctggc cgccgctttt       600
     ggcgtggcgg tacttccgtc ggccggcatc gatcgggccg ccgtctcccg gctcggacct       660
     ccccccgaaa cggctatact tcagaccatg caagccggtg aagaccacgt cgagccggaa       720
     gcgctcgccg accgcctcat gaccggcgat ccgtcgctcc tgctggtgga catccggact       780
     ccgggggaat attccgcctt tcacatcaag ggcgccttga acgtcgcccc cgccgacctc       840
     cctgaaaccc tcgctccccg cagggacagg gggaccatcg tcctctattc caacgggatg       900
     acccaccccg cccaggcacg agatgccctg gcacgcatgg ggttcaacaa tgtcaccatc       960
     ctgaccgacg gtttgcaggg tttcatgcac cgcgtgctga aacccgtttc actgcgtgaa      1020
     gcgccgctca ccgccgaaat ggcggctcag gtggaagcgt ggcgcgggtt cttcctgggg      1080
     accgcgaccg cccgggccga tgattcgcaa gggagcaccg gcggcatgcc cgggctggtc      1140
     gaaacggcgt ggctgaacga gcacctcggg cgcggcgacg tgcgcatcat cgagacacgt      1200
     tcccagcccg cctacaacgg cggtcacctg cccggctcgg tgcggatgga cccggagcat      1260
     ttccgcgggg tggtcggcgg ggtgtcgtcc atggtgctgc ctgtcgacat gattgtccgg      1320
     cacctggagt tgctgggcat caggcccgaa acgacgatcg tcgtcgtgcc gagcgagaag      1380
     atcatggacg caacactcat cgggaccgcc ctggaacggg ccgggcaccg gcgctacgcc      1440
     attctgaacg gaggctggga aaaatggctg gcggaacgtc gcccggtgga tactctgctg      1500
     cccgccatca ccgaaaccgc ctatcccgcc ccgcgagagg cggaccggtt caccgtggat      1560
     taccggaccg tgctggagca tgtgcatcgg cgcagcgcgg tgctgctgga tgtgaggccc      1620
     gccgactatt tttcgggggc gaagtccgac gaagcccgcg cagggcatat tccgggagcc      1680
     gtcaaccgtc ctttcgccga cgacctggcg acaatcgacg gcatcacgag tttcaagccg      1740
     cgggcggagc tcgaagaggc ctacgcgcgc ctgattccct ccaaggacac gacggtggtg      1800
     gtctcctgcc gcacggggca tcaggccagc cagacgcgct tcgtgctcca aaacatactg      1860
     gggtatcgga aggtgttctg gtacgacggc gggtgggcgg agtggtccag ccggccggaa      1920
     ctgcccgtgg aaacgtcccc gtga                                             1944
//

If you have problems or comments...

PBIL Back to PBIL home page