(data stored in ACNUC7421 zone)

EMBL: CP000478.PE508

CP000478.PE508       Location/Qualifiers
FT   CDS_pept        complement(619093..619623)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sfum_0512"
FT                   /product="protein of unknown function DUF395, YeeE/YedE"
FT                   /note="PFAM: protein of unknown function DUF395, YeeE/YedE;
FT                   KEGG: ade:Adeh_2630 protein of unknown function DUF395,
FT                   YeeE/YedE"
FT                   /db_xref="EnsemblGenomes-Gn:Sfum_0512"
FT                   /db_xref="EnsemblGenomes-Tr:ABK16212"
FT                   /db_xref="GOA:A0LFL0"
FT                   /db_xref="InterPro:IPR007272"
FT                   /db_xref="UniProtKB/TrEMBL:A0LFL0"
FT                   /protein_id="ABK16212.1"
FT                   /translation="MNPDQSIHSNGPRPYMNPYLAGLILGAVLLAAFLVLGTGLGASGG
FT                   IARVGAAAQGALMPQHVAGSPYFGAWGSNPLSYYLVFMFAGTLLGGLVSAVAARRVQPQ
FT                   LERGPTASPRRRILMALSGGVLAGFASRLASGCTSGQALTGGAMLATGSLLFLVSLFAA
FT                   GYAAAWFARRQWS"
     atgaatcccg accaatccat tcattcaaac ggtcccaggc catacatgaa cccctatttg        60
     gccggtttga tcctgggcgc cgtgcttctt gccgccttcc tggtcctggg aaccggtctc       120
     ggagcatccg gaggcatcgc ccgcgtgggc gccgcggcgc agggcgcgct gatgccgcaa       180
     catgttgcgg gcagtcccta cttcggcgcc tggggaagta atccgctcag ttactacctg       240
     gtcttcatgt ttgcgggcac ccttctcggg ggcctggtgt ccgccgttgc ggcacgccgg       300
     gtccagccgc agctcgagcg cgggccgacg gcctcgcccc gacggcgtat cctcatggct       360
     ttgtcgggcg gagtcctggc gggctttgcc agccgcctgg cttcgggctg cacctcgggc       420
     caggcgctca caggcggagc aatgctggcc accggcagcc tgctctttct cgtatccctt       480
     tttgccgccg gttacgccgc cgcgtggttc gccaggaggc aatggtcatg a                531
//

If you have problems or comments...

PBIL Back to PBIL home page