(data stored in ACNUC7421 zone)

EMBL: CP000478.PE509

CP000478.PE509       Location/Qualifiers
FT   CDS_pept        complement(619802..621655)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sfum_0513"
FT                   /product="beta-lactamase domain protein"
FT                   /note="PFAM: beta-lactamase domain protein; Rhodanese
FT                   domain protein; KEGG: rha:RHA1_ro08897 possible hydrolase"
FT                   /db_xref="EnsemblGenomes-Gn:Sfum_0513"
FT                   /db_xref="EnsemblGenomes-Tr:ABK16213"
FT                   /db_xref="InterPro:IPR001279"
FT                   /db_xref="InterPro:IPR001763"
FT                   /db_xref="InterPro:IPR036866"
FT                   /db_xref="InterPro:IPR036873"
FT                   /db_xref="UniProtKB/TrEMBL:A0LFL1"
FT                   /protein_id="ABK16213.1"
FT                   /translation="MQFNLPVLSHYSYLLISGKEALLVDPDRDITAYLDHAKKHGLTIK
FT                   GVFLTHSHADFVAGHLELVRALNVPVYQNAASGAKYKIEPLKEGSTFKVGAAMVKAVET
FT                   PGHTPDGMCGLVFSEGDDQPKMIFTGDTLFVGSVGRPDLLEGKMTAATLASMSYDTWHN
FT                   VLSKLPDTVAVLPAHGAGSLCGAHLSDDPSSTIGRERSSNPYIRHKGRSEFISAVLEGL
FT                   PEAPQYFKHNAAMNREGPPLVSWDAAPVQAKVDESITRVEDLWLVDLRDPKPYSEGHVP
FT                   GSVNIGLRGRLETWVGTIVPWKAPMVLIGSSAEIKEAVLRLHRVGYTGSVLPFEAWTRA
FT                   GLSLARSGTVKPGELYAQMQDGSAPIIVDVRLPNEWMALRIGTVVNLPLNHLGELSRKL
FT                   DPALPVVAVCNSAYRSSLAVGILQRKGFKQVSSLEGGSAAWIEAGYPVFGSEKQAAGSS
FT                   APRRHVHLAERISPADLNRLLKDLPGTFDLVDIRPPEAFRDYSLPGSTNADPADVLSNA
FT                   GYLTGAGPLIIVDRDGSLAMMIAGILSQKTKRPIKALHGGLDAFWEETELKAAVRAVPL
FT                   PGGGPKFQGPAAPAPAPVPQPATSAPAPSTPGTPKKKSAGC"
     gtgcagttca acctgcccgt cttgagccac tattcctacc tgctgatttc cgggaaggag        60
     gcgctcttgg ttgatccgga ccgggacatc accgcctacc tcgaccatgc gaaaaaacac       120
     ggcctgacca tcaagggcgt ctttctcacc cactcccacg ccgacttcgt cgccggacac       180
     ctggaactgg tccgggcatt gaacgtcccc gtctatcaga acgccgccag tggcgcaaaa       240
     tacaagatcg aaccgctgaa agaaggctcg acgttcaagg tgggcgcggc catggtgaaa       300
     gccgtggaga ctcccggcca cacgcccgac ggcatgtgcg gcctggtttt ttcggagggg       360
     gatgaccagc cgaaaatgat tttcaccggg gataccctgt ttgtcggatc cgtcggaaga       420
     ccggatctgc tcgaagggaa aatgaccgcc gccaccctgg cttccatgag ctacgacacc       480
     tggcacaatg tcctgtccaa acttccggac acggtcgcgg tgctgcccgc gcacggtgcg       540
     ggttccttgt gcggcgcgca cctgtccgac gatccttcgt cgaccatcgg cagggaaagg       600
     tcgtccaatc cgtacatacg gcacaagggc cgcagcgagt tcatctcggc ggtgctcgaa       660
     ggcctgcccg aggcaccgca gtacttcaag cacaacgccg ccatgaaccg tgaaggaccg       720
     cccctggtgt cgtgggatgc ggcgcccgtc caggcgaaag tcgatgaatc catcacccgg       780
     gtggaagacc tgtggctggt cgacctgcgg gatcccaagc cctactctga agggcatgtt       840
     ccgggatcgg tgaacatcgg gctgcgaggc cgcctggaaa cgtgggtggg cacaatcgtg       900
     ccttggaagg ccccgatggt gctgatcggt tcttcggcgg aaatcaagga agccgtcctg       960
     cgcctgcatc gagtgggtta cacgggatcg gtgctgccgt tcgaggcctg gaccagggcc      1020
     ggcctgagtc ttgcccggag cgggaccgtc aagcccggcg agctttacgc tcaaatgcag      1080
     gacggcagcg ctcccatcat cgtggacgtg cgcctgccca acgaatggat ggcgctgcgc      1140
     atcgggacgg tggtgaacct gcccctcaac cacctgggtg agctttcccg caaactcgat      1200
     cccgctctgc cggtggtggc ggtctgcaac agtgcgtacc ggtcgagcct ggcggtgggc      1260
     atcctgcagc gcaaaggatt caagcaggtt tcaagcctcg aagggggcag cgcggcgtgg      1320
     attgaagcgg gctacccggt attcggaagc gagaagcaag ccgccggctc ctccgcaccc      1380
     aggcgtcacg ttcatcttgc ggaacggatc tccccggcgg atttgaatcg gctgctcaag      1440
     gatttgccgg gaacattcga cctggtggac attcgcccgc cggaggcatt ccgggattat      1500
     tccctgcccg gatcgaccaa cgccgatccg gcggacgtcc tgtcgaacgc ggggtacctc      1560
     acgggcgcgg gaccattgat catcgtggac cgcgacggct ccctggcgat gatgatcgcc      1620
     ggcattcttt cacagaagac caagagaccg atcaaggccc tgcacggcgg gctcgatgcc      1680
     ttctgggagg agacggagtt gaaggccgcc gtgcgggcgg tgccgcttcc cggcggggga      1740
     cctaaattcc aggggccagc agccccggcc ccggctccgg tcccgcagcc cgcgacttcg      1800
     gcgcccgctc cgtccactcc cggcacgccc aaaaagaagt cggccggctg ttga            1854
//

If you have problems or comments...

PBIL Back to PBIL home page