(data stored in ACNUC7421 zone)

EMBL: CP000478.PE51

CP000478.PE51        Location/Qualifiers
FT   CDS_pept        complement(67652..67909)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sfum_0052"
FT                   /product="TRASH domain protein"
FT                   /note="SMART: TRASH domain protein; KEGG: dps:DP0429
FT                   hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sfum_0052"
FT                   /db_xref="EnsemblGenomes-Tr:ABK15755"
FT                   /db_xref="InterPro:IPR011017"
FT                   /db_xref="UniProtKB/TrEMBL:A0LEA3"
FT                   /protein_id="ABK15755.1"
FT                   /translation="MGRFIIIATLIFVGYLLAKRYFHLLAGKMNRNDSAENDATELVQD
FT                   PQCGTYFARQQGVEARIDGQTVYFCSETCRGKYLEKHRSG"
     atgggccgat tcattattat tgcaacactc atttttgtgg gctatctgtt ggcaaagcgc        60
     tattttcatt tgcttgccgg aaaaatgaac cggaacgaca gtgccgagaa cgacgccacg       120
     gagctcgttc aggaccctca gtgcggcacc tattttgcca ggcaacaggg cgtggaagcc       180
     agaatcgacg ggcagaccgt gtacttctgc agtgaaacct gccgcggcaa atacctggaa       240
     aaacaccgtt ccgggtag                                                     258
//

If you have problems or comments...

PBIL Back to PBIL home page