(data stored in ACNUC7421 zone)

EMBL: CP000478.PE512

CP000478.PE512       Location/Qualifiers
FT   CDS_pept        625102..625488
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sfum_0516"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sfum_0516"
FT                   /db_xref="EnsemblGenomes-Tr:ABK16216"
FT                   /db_xref="UniProtKB/TrEMBL:A0LFL4"
FT                   /protein_id="ABK16216.1"
FT                   /translation="MASRSGNGAFDESPLRDKTLERADFRRKASGRQLSINSSIAAKLC
FT                   PWTRMGDVDTNGWRREPKGSPQVFRTGRDEQTSEQIGTVKAAGAERFASGVHTARKAPR
FT                   YPLTIPGRGVIRGLRSGWVHRAGA"
     gtggcatctc gaagcgggaa cggagcattt gatgaatccc cgctgcggga caaaacgctc        60
     gaacgcgccg attttcgccg gaaagcctcc ggcagacagc tttcgatcaa ttctagcatc       120
     gccgcgaaac tgtgtccatg gacacgaatg ggagatgtcg acacgaatgg gtggcggaga       180
     gagccgaagg gttcgccgca ggtttttcgg acaggccgcg acgaacaaac aagcgaacag       240
     atcgggacgg tcaaagcggc gggtgccgaa cgttttgcgt ccggcgttca tacggctcgc       300
     aaggctcccc gatatccttt gaccattccg ggccggggag tgatacgcgg gttgcgttcg       360
     ggatgggtgc atcgggcggg ggcataa                                           387
//

If you have problems or comments...

PBIL Back to PBIL home page