(data stored in ACNUC7421 zone)

EMBL: CP000478.PE514

CP000478.PE514       Location/Qualifiers
FT   CDS_pept        627279..629387
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sfum_0518"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: sma:SAV2604 secreted protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sfum_0518"
FT                   /db_xref="EnsemblGenomes-Tr:ABK16218"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:A0LFL6"
FT                   /protein_id="ABK16218.1"
FT                   /translation="MNSMKRTIAVSVIALAIALGTSWAGAATLEVIDGEYKLPARIHAS
FT                   VASDVKTELWAHVWRPRPRGSYPLVVFLHGNHPTCGRYDSELGVRIDDRVDYTTTGECP
FT                   SGYVVTPNHLGYAYLAGTLASYGYVVVSINANRGVNGAKPETDDYGLNLRRGRLVLRHL
FT                   QELAKWNTEGGAPASLGFQLKGFIDFTQVGLMGHSRGGEGMRAAVAQLNDPDSLWPKRI
FT                   PGLKFRSLFEIGPVDGQTSRTLNPVGVVWNVLLPGCDGDVADLEGMKPFDRMLQDAAEA
FT                   DSLSKSTFQVFGANHNFYNTQWQISDSMGCIGQTAIFPQLKGSASQRRTALRSLVPFFR
FT                   SNLGPAPVEGLARRFDPSFPIPSGLASETSYARGFTRSPRRCENFVIDNFNRRTGLSSR
FT                   NVANESSGLSGYEHGTAGKNQDPTQRAAAIDWRRAGGFFQVNAAAAGEGLDVGNYHALE
FT                   FRVMLRCFDKLCCSPGDPTGDVDFSIAIANADAVLSNPVSLKSVAVVRRPGGSFQGSWV
FT                   NYNELFQTVRIPLSDFTGADLSNFRGVRFTFDRSPKSFIYLANVRLTKARAGNGALASD
FT                   AQTQVGSETVVQTRARDEAQADRNEIVAIRLPGGAAAGVSEKARVPAVEIEVASSRSFP
FT                   VGGALPTLVVGDKTFALSHYPSGATDRLVFTLEAGQFEAIEQGAEVGVRIGGARPWHFG
FT                   LLDKSLAR"
     atgaattcca tgaagagaac catcgccgtt tcggttattg ccctggcaat cgcgctcgga        60
     acctcatggg cgggtgcggc aacccttgaa gtgatagacg gggaatacaa gctgcccgcc       120
     agaatccatg cctcggtggc atccgacgtg aagacggaac tgtgggctca tgtctggcgc       180
     ccgcgcccgc gcggatccta tccattggtg gtttttcttc atgggaacca ccccacctgc       240
     gggcgatacg acagtgaact gggcgtgcga atagacgatc gcgtcgatta tacgacgacc       300
     ggcgagtgcc cgtccggcta cgtggtgacc cccaatcatc tcggttacgc ctatcttgcg       360
     gggactctcg cctcgtacgg atacgtggtc gtttccatca atgccaaccg cggcgtcaac       420
     ggagccaagc cggaaaccga cgactacggt ctcaacctgc gacgcggacg tcttgttttg       480
     cgccacctgc aggaactggc gaaatggaac accgaaggcg gcgcgcccgc ttcgctcggt       540
     tttcaactca agggtttcat cgacttcacc caggtcgggc tgatggggca ttctcgcggc       600
     ggggagggca tgcgcgcggc cgtggcccag ttgaacgatc ccgacagtct ttggccgaaa       660
     cgtatcccgg ggctcaaatt tcgctccctg ttcgagatcg gccccgtcga tggtcagacg       720
     agtcgcaccc tgaaccctgt gggtgttgtg tggaacgtcc ttctgcccgg ctgcgacggg       780
     gacgtcgcgg acctcgaggg gatgaagccg ttcgaccgga tgctccagga cgcggcggag       840
     gcggattcgc tgagcaaatc cacctttcag gtcttcggtg caaaccacaa tttctacaac       900
     acgcaatggc agatttcgga ctccatggga tgcatcgggc agacagcgat ctttccccag       960
     ttgaaaggat cagcgtctca gcgccgcact gcgctgcggt cgctggtgcc gttcttccgc      1020
     tccaatttgg ggcccgcgcc cgtcgaaggg ctggccaggc gtttcgatcc cagcttcccc      1080
     ataccgtcgg gactggcttc ggagacgtca tacgctcggg gtttcacgcg gagcccccgc      1140
     cgatgcgaga attttgtcat cgacaatttc aaccggcgga ccgggctttc gagtcggaat      1200
     gtggccaatg aatcctcggg gctttcgggc tacgaacatg gaacggccgg caagaaccag      1260
     gatccgacgc agcgtgccgc cgcgatcgac tggcgcagag cgggcggatt tttccaggtc      1320
     aacgccgccg ccgcgggcga ggggctggac gtcggcaact accacgccct cgaattccgc      1380
     gtgatgctgc gctgcttcga caaactctgc tgctcgccgg gcgatccgac cggggacgtc      1440
     gacttttcga tagccatcgc caatgccgat gccgttctct ccaatccggt gtctctcaaa      1500
     tccgtggccg tggtgcgccg cccgggcggt tcgtttcagg gcagttgggt caactataac      1560
     gagctgttcc agaccgttcg cattccgctg tccgatttca cgggtgccga tctgtccaat      1620
     ttccgcggcg ttcgtttcac cttcgatcgc agtccaaaat ctttcattta ccttgcgaat      1680
     gtgcgcctga ccaaggcccg cgccggaaac ggcgctctcg catcggatgc gcaaacgcaa      1740
     gtcgggagcg aaaccgtggt gcaaacccgc gcgcgggatg aagcccaagc ggatcgcaac      1800
     gagatcgtcg ccatccgcct cccgggcggg gcggccgccg gcgtatcgga gaaggcgcgc      1860
     gttccggccg tggagatcga ggtcgcttcg agccgttcgt ttccggtggg tggagcgctg      1920
     ccgacgctcg tcgtgggcga caagaccttc gctctttcgc actacccgtc cggcgccacc      1980
     gatcgactgg tgttcaccct ggaggcgggc caattcgagg cgatcgagca gggagccgaa      2040
     gtcggcgttc gcatcggcgg cgcgcgcccc tggcatttcg gcctgctcga caagtcgctt      2100
     gcccgctga                                                              2109
//

If you have problems or comments...

PBIL Back to PBIL home page