(data stored in ACNUC7421 zone)

EMBL: CP000478.PE517

CP000478.PE517       Location/Qualifiers
FT   CDS_pept        631597..631875
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sfum_0521"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sfum_0521"
FT                   /db_xref="EnsemblGenomes-Tr:ABK16221"
FT                   /db_xref="UniProtKB/TrEMBL:A0LFL9"
FT                   /protein_id="ABK16221.1"
FT                   /translation="MPAISPVMADRSCPADRPVVAKDCCFTLHGRHTVAPSRRVSRIPG
FT                   IGAFFTSFLCMHLSVFPGGVLQQYAIVAHSARLMFDGDQRVIACEPE"
     ttgccggcca tcagccccgt catggccgat cggtcctgcc cggccgatcg gccggtagtg        60
     gcaaaagatt gttgtttcac actgcatggc aggcacaccg tggcgccatc ccgtcgggtt       120
     tcaagaatcc ccggcatcgg cgccttcttc acgtcctttc tatgcatgca cctttccgtg       180
     ttccccggcg gggtcctgca acaatatgcc atcgttgcgc acagtgccag gcttatgttt       240
     gacggtgacc aacgggtcat tgcgtgtgaa ccggaatga                              279
//

If you have problems or comments...

PBIL Back to PBIL home page