(data stored in ACNUC7421 zone)

EMBL: CP000478.PE524

CP000478.PE524       Location/Qualifiers
FT   CDS_pept        643230..643544
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sfum_0529"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sfum_0529"
FT                   /db_xref="EnsemblGenomes-Tr:ABK16228"
FT                   /db_xref="UniProtKB/TrEMBL:A0LFM6"
FT                   /protein_id="ABK16228.1"
FT                   /translation="MRTFRDHLQEKLQDKRFGELFDEEKELVRIGIEVAEARAKLGMSQ
FT                   ADLQMHREIRPPAGSESFLYMPASIKKENGPKTVLEKATASDVPSEVLARFQKSPSKAS
FT                   "
     atgagaactt tcagggatca cctgcaggag aagttgcagg acaaacggtt cggagaactc        60
     tttgatgaag aaaaggaact tgtccggatc ggcatcgaag tggccgaggc cagggccaag       120
     ctcgggatga gccaggctga tctgcaaatg caccgggaga tccggccccc ggccgggtcc       180
     gaatcgtttc tttatatgcc tgcgtccatc aaaaaagaaa acggtccgaa gaccgtcttg       240
     gagaaggcca cagcgagcga tgtcccctct gaagtgcttg cgcgctttca gaagtccccc       300
     tctaaagcgt cctga                                                        315
//

If you have problems or comments...

PBIL Back to PBIL home page