(data stored in ACNUC7421 zone)

EMBL: CP000478.PE529

CP000478.PE529       Location/Qualifiers
FT   CDS_pept        complement(651975..653369)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sfum_0534"
FT                   /product="FAD linked oxidase domain protein"
FT                   /note="PFAM: FAD linked oxidase domain protein; KEGG:
FT                   gsu:GSU3296 glycolate oxidase subunit GlcD, putative"
FT                   /db_xref="EnsemblGenomes-Gn:Sfum_0534"
FT                   /db_xref="EnsemblGenomes-Tr:ABK16233"
FT                   /db_xref="GOA:A0LFN1"
FT                   /db_xref="InterPro:IPR004113"
FT                   /db_xref="InterPro:IPR006094"
FT                   /db_xref="InterPro:IPR016164"
FT                   /db_xref="InterPro:IPR016166"
FT                   /db_xref="InterPro:IPR016171"
FT                   /db_xref="InterPro:IPR036318"
FT                   /db_xref="UniProtKB/TrEMBL:A0LFN1"
FT                   /protein_id="ABK16233.1"
FT                   /translation="MTIPITEITRIVGKDHVLTAPEELHCYGYDASKMKARPECVVFPG
FT                   SAAETAELLVLANRDRFPVYPRGAGTGMVGAAIPSGGGLVVALNRLNRILEIDAENMTA
FT                   IVEPAVVTGDFQKRVLECGLFYPPDPASLQFSTLGGNVAMCAGGPRAVKYGVTRDYVLG
FT                   LEVVLPTGSIIRTGTRTMKGVVGYDLTRLMVGSEGTLGIFTKIILRLIPAPEGVRTMMA
FT                   VFPRLDDAANAVCDIIKHRIVPSTLEFMDQPTIGVVENYLHAGLPTEAEAILLIEADGR
FT                   EALLDEDASQIERLCREAGADAFKTGRSPAEREQLWKARRAISPALGQIRPGKINEDVT
FT                   VPRTLIPSLIRFIQGLASRHRLTIVCFGHLGDGNIHTNIMLDRKDADERKRAERAVEEL
FT                   FRKVLELGGTLSGEHGIGIAKSPFLELEVGRDGLAAMLRIKQALDPLNILNPGKMFVPN
FT                   RAFFGE"
     atgacgatcc cgataaccga aataacccgc atcgtcggca aggaccacgt gctgaccgct        60
     cccgaggaac ttcactgcta cggttatgat gcgagcaaaa tgaaggccag gccggaatgc       120
     gtggtctttc ccggaagcgc cgcggaaacg gcggagttgc tggtgcttgc caaccgggat       180
     cgtttccccg tgtaccctcg aggcgcgggc acgggaatgg tcggcgcggc cattcccagc       240
     ggcggcggcc tggtggtggc cctcaaccgg ctgaacagga tcctcgaaat cgatgctgaa       300
     aacatgacgg cgatcgtgga accggccgtc gtcaccgggg atttccagaa acgggttctc       360
     gagtgcgggc ttttctaccc gcccgatccg gcgagcctcc agttttccac gctgggagga       420
     aacgttgcga tgtgcgcggg cggcccgaga gccgtcaagt acggagtcac acgcgattac       480
     gtgttgggac tcgaagtcgt ccttcccacc ggttccatca tccgcacggg aacccggacc       540
     atgaaggggg tcgtcggata cgacctcacg cgactcatgg tgggttcgga agggacgctc       600
     ggcatcttca ccaagatcat cctccgcctg atccccgccc cggaaggcgt tcgcaccatg       660
     atggccgtct ttcccaggct cgacgacgcc gccaatgcgg tatgcgacat catcaagcac       720
     aggatcgtcc catccaccct ggagttcatg gatcagccca ccattggagt ggtggagaat       780
     tacctgcatg ccgggctgcc gaccgaggcc gaggccattc tgctcatcga ggcggacggc       840
     cgggaggcgc tgctcgacga ggacgcttcc cagatcgaac ggctctgccg cgaggccggc       900
     gccgacgcgt tcaagaccgg cagatccccg gcggaacgcg agcagctctg gaaagcgcgc       960
     agggccattt cgcccgccct gggccagatc cgccccggca agatcaacga agacgtgacc      1020
     gttccgagga ctctcatccc gtcgctcatc cgcttcatcc agggactggc gtcaaggcac      1080
     cgcctgacca tcgtctgctt cggccacctc ggcgacggaa acatccacac caatatcatg      1140
     ctcgaccgca aggacgccga tgagcgcaag agggccgaga gggccgtcga ggaactgttc      1200
     cggaaggttc tcgagctcgg cggcacgctt tccggcgaac atggcatagg aatcgccaag      1260
     tcaccctttc tcgagctgga agtgggacgg gacggccttg ccgccatgct caggatcaaa      1320
     caggccctgg acccattgaa cattctgaac cccgggaaga tgttcgtccc caaccgggct      1380
     tttttcggcg agtga                                                       1395
//

If you have problems or comments...

PBIL Back to PBIL home page