(data stored in ACNUC7421 zone)

EMBL: CP000478.PE530

CP000478.PE530       Location/Qualifiers
FT   CDS_pept        653891..655063
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sfum_0535"
FT                   /product="Uncharacterised conserved protein UCP016719"
FT                   /note="PFAM: Uncharacterised conserved protein UCP016719;
FT                   KEGG: dps:DP2946 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sfum_0535"
FT                   /db_xref="EnsemblGenomes-Tr:ABK16234"
FT                   /db_xref="InterPro:IPR008302"
FT                   /db_xref="UniProtKB/TrEMBL:A0LFN2"
FT                   /protein_id="ABK16234.1"
FT                   /translation="MGKVILGCEVLASSPPGWFRSGRLGLLVNQASVTQSFEHVRDLLR
FT                   RTGGRLTCLLSPQHGFHSEKQANMIESDDSWDEDSSLPVVSLYGKVRQPSRETLDGIDV
FT                   LVIDLQDVGTRVYTYGVTMGLCLEAAARSGTKVVVLDRPNPIGGISIEGNILDDGYRSF
FT                   VGRYPIPMRHGLTMGELARFICKECSVDCDLQVIPMKGWRRRDYFPDTGLPWFFPSPNM
FT                   PTWETALLYPGMVLLEGTNVSEGRGTTLPFHVFGAPFVNRRRLGDYLAGAGLEGVVFRP
FT                   VSFEPMFDKWRGRLCHGFQIHVTDRVSFSPYRLGLTLIRGLRLLNPDEFKWLEPPYEYE
FT                   TEKLPIDILLGDGKLREKLDNGADPGGVARGWANPLAAYWAKCAGLFLYA"
     atggggaaag tgattctcgg atgcgaggtt ttggcctcga gccctcccgg ctggtttcga        60
     tccggccggc tcggtctttt ggtaaaccag gcgtccgtca ctcagtcttt cgagcatgtc       120
     agggatctgc tgcgtcggac aggcggaagg ctgacctgcc tgttgtctcc acagcacgga       180
     tttcattccg agaagcaggc gaacatgatc gagtccgacg actcctggga cgaggactcc       240
     tcccttcccg tcgtcagcct gtatgggaaa gtccgacagc cttcccggga gacgctggac       300
     ggcatcgatg tcctggtgat cgatctgcag gacgtcggaa cgcgggtata tacctacggc       360
     gtgacgatgg gactgtgcct cgaggccgcg gcccgctccg ggacaaaggt ggtggtcctt       420
     gaccggccca accccatcgg gggcatctcc atcgagggga atatactcga tgacgggtac       480
     cgttcattcg tgggcagata tcccattccc atgcgtcacg gtctcaccat gggtgagctg       540
     gcacggttca tctgcaaaga atgcagcgtg gactgcgatc ttcaggtcat tccgatgaag       600
     gggtggcggc ggcgtgacta tttcccggac accggcctcc cctggttctt cccgtccccc       660
     aatatgccca cctgggaaac ggctttgctc tatcccggca tggtgctgct cgaaggcacg       720
     aacgtgagcg agggcagggg cacaacgctc ccgttccacg tattcggtgc gccgttcgtc       780
     aaccggcgcc gccttggaga ctatctggcg ggtgcgggac tggagggggt tgtttttcgg       840
     ccggtgagct tcgagccgat gttcgacaaa tggcggggca gactctgcca tgggtttcag       900
     atccatgtca ccgaccgtgt ttccttttct ccctatcgcc tgggcctgac gttgatccgc       960
     gggctgagac ttctcaatcc ggatgagttc aaatggctgg agccgccgta cgaatatgaa      1020
     acggaaaagc ttcccatcga tattttgctt ggggacggga agctcaggga gaagctcgac      1080
     aacggagcgg accccggagg agtggcgcga ggttgggcaa acccgcttgc ggcctattgg      1140
     gcgaagtgtg cagggctttt tctctacgcc tga                                   1173
//

If you have problems or comments...

PBIL Back to PBIL home page