(data stored in ACNUC7421 zone)

EMBL: CP000478.PE532

CP000478.PE532       Location/Qualifiers
FT   CDS_pept        656161..657213
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sfum_0537"
FT                   /product="type IV pilus assembly protein PilM"
FT                   /note="TIGRFAM: type IV pilus assembly protein PilM; KEGG:
FT                   ade:Adeh_0641 type IV pilus assembly protein PilM"
FT                   /db_xref="EnsemblGenomes-Gn:Sfum_0537"
FT                   /db_xref="EnsemblGenomes-Tr:ABK16236"
FT                   /db_xref="GOA:A0LFN4"
FT                   /db_xref="InterPro:IPR003494"
FT                   /db_xref="InterPro:IPR005883"
FT                   /db_xref="UniProtKB/TrEMBL:A0LFN4"
FT                   /protein_id="ABK16236.1"
FT                   /translation="MFAKKENLLGLDIGSHSVKLTQLKAKEGRLTLANVGLVPVPREAF
FT                   NEGRVNKPDLVSNCIKHLTSHLKVKERTVATAVSGYEVMIKKIELPTMTEEELDSRMHA
FT                   ELGQYIPYNIEEVDVDYQVLDVAKDRPNYMGVLLVAAKKESIGDCVGIVRAAGLDTDVV
FT                   DVDFFALSNAFEATYGSFEGNIALIDIGSAKAIMNIASNGVPVFTRGISIGGSQITESI
FT                   RDYFKVSYEEAERLKLGEISVNFPVKEIEGLFVSTVRNWVSECKRAIDFYYSNYPDKTI
FT                   QRIFLSGGSCRIPGLDRVFQENMGVAVEIFNPFKRVDCDPKLFDPEYIEFIGPQMAISL
FT                   GLALRKTKEK"
     atgtttgcaa aaaaagagaa tctactgggc ttggacattg gctcccactc cgtcaagttg        60
     acacagttga aagccaagga gggcaggctc actctggcga acgtcgggct agtcccggtt       120
     ccgcgtgagg cgttcaacga gggcagagtg aacaaacctg accttgtgtc caactgcatc       180
     aagcatctga cctctcactt gaaggtcaaa gagaggaccg tggcgacggc ggtatccgga       240
     tatgaggtga tgatcaagaa aatcgagctg cccaccatga cggaggagga actcgacagt       300
     cgcatgcatg cggagctcgg tcagtacatt ccctacaaca tcgaggaggt ggatgtcgac       360
     taccaggtgc tggatgtcgc caaggaccgt ccgaattaca tgggcgtgct gctggtcgcg       420
     gccaagaagg aatccatcgg cgactgcgtg ggaatcgtca gggccgcggg gctggacacg       480
     gacgtggtgg atgttgattt cttcgccttg agcaatgctt ttgaagcgac atacggcagt       540
     ttcgaaggga atattgctct tattgacata ggttctgcca aagccattat gaatattgct       600
     tccaacgggg ttcccgtatt cacaaggggt atatctatcg ggggaagcca gattaccgag       660
     agcatccggg attacttcaa ggtgagctat gaagaggcgg agcggttgaa gctgggggaa       720
     atctcggtga attttccggt aaaggaaatt gaggggctgt tcgtctcgac ggtcaggaac       780
     tgggtgagcg agtgcaaacg ggcaatagat ttctactaca gcaattatcc ggacaagacc       840
     attcagagga ttttcctcag cgggggatcc tgccgtattc cgggactgga ccgcgtgttt       900
     caggagaaca tgggagtggc ggtggaaata ttcaacccat tcaaacgggt ggactgtgac       960
     ccgaagttgt ttgatccgga gtatattgag tttattggcc cgcagatggc aatatcactt      1020
     ggattggcgc taagaaagac aaaagagaaa tga                                   1053
//

If you have problems or comments...

PBIL Back to PBIL home page