(data stored in ACNUC7421 zone)

EMBL: CP000478.PE535

CP000478.PE535       Location/Qualifiers
FT   CDS_pept        658509..660419
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sfum_0540"
FT                   /product="type IV pilus secretin PilQ"
FT                   /note="TIGRFAM: type IV pilus secretin PilQ; PFAM: type II
FT                   and III secretion system protein; Secretin/TonB, short
FT                   N-terminal domain; KEGG: ade:Adeh_0645 type II and III
FT                   secretion system protein, secretin"
FT                   /db_xref="EnsemblGenomes-Gn:Sfum_0540"
FT                   /db_xref="EnsemblGenomes-Tr:ABK16239"
FT                   /db_xref="GOA:A0LFN7"
FT                   /db_xref="InterPro:IPR001775"
FT                   /db_xref="InterPro:IPR004846"
FT                   /db_xref="InterPro:IPR005644"
FT                   /db_xref="InterPro:IPR011662"
FT                   /db_xref="InterPro:IPR013355"
FT                   /db_xref="InterPro:IPR038591"
FT                   /db_xref="UniProtKB/TrEMBL:A0LFN7"
FT                   /protein_id="ABK16239.1"
FT                   /translation="MHYVGFRKMSCFAFVLVFALCWACAIPGSVEGGSSPKAGVASPSP
FT                   AAATPTAESATAGKGAKLLSVAMDESGLETVLRIAGSGPLKDYQFRRLGEDRFVLEIGD
FT                   VTARAAKPALPGKSSRVKLNYARAKAGVRIVGNVRQPISDYTVDSVDNDIVVNLRFAEK
FT                   KQVAAAGAAAEKPATAEKTRPGKAAARRGAGDAGEEVQGADQQFPEYSATRPGGGAPEL
FT                   RHARKQYTGKPISLDLLDADLRNVLRLLADLTGTNIVIEPDVTGKVTLKVEQVPWDQVL
FT                   DMIISMNDLGQEQVGSVIRIARRSKLKSEWAQQAEAIRAKQEYLLTSKDLGEINTAYLT
FT                   VNYAQVTDVASKINEAKSDKGKVSVDERTSLIIYSDYPGRINNARMLLNRLDRPTSQVL
FT                   IEARIITLTSEVKRSLGMNLGFGGDTPNHSATVPFTDFLINSPPANLFALNLAQMVGTT
FT                   LLKVDLTISALETADEIRIMAAPRVLTMNNVKAVISQGVQIPYLKVGDTASNITGTDFK
FT                   DAVLELAVTPHITPDHKVRMTIEAKQDEPSSTVTGAQGQPGIDTRKISTELLVDDGNII
FT                   VIGGIIRNRDEAKKTATPGLSDVPILGRLFKSNEVDAQRNEILIFICPKIVDVTKPSDR
FT                   T"
     atgcattacg tcggttttcg aaaaatgagc tgtttcgctt ttgtattggt gtttgccttg        60
     tgctgggctt gtgcgattcc cggctccgtc gaaggcggat ccagcccgaa agccggtgtt       120
     gcgagcccga gccctgcggc agccacgccg acggccgaat ctgcaacggc gggaaaaggc       180
     gcgaagttgt tgagtgtcgc tatggacgaa tccgggttgg agacggtgct caggatagcg       240
     ggcagcggcc ccttgaagga ttatcaattc cggcgcctgg gcgaagacag attcgtgctg       300
     gaaatcgggg atgtgaccgc cagggcggcc aagcccgcgc tgcccggcaa gtcgagcagg       360
     gtcaagctca actatgcgcg agcgaaggcg ggggtccgga tcgtcgggaa tgtccggcag       420
     cccatcagtg attataccgt cgacagtgtc gacaacgaca ttgttgtgaa cctgcgtttc       480
     gcggaaaaga agcaggttgc ggcggccggc gccgctgcgg agaaacctgc cacggcggaa       540
     aagaccaggc cgggcaaggc tgcggcgcgc cgtggagccg gcgatgccgg ggaggaagtc       600
     cagggggcgg accagcagtt ccccgaatat tcagccacca ggccgggggg gggagccccc       660
     gaattgcgtc atgccaggaa gcagtacacg ggcaaaccga tcagccttga tctgctcgac       720
     gccgatctgc ggaacgtcct gcggcttctg gccgatctga ccgggacgaa cattgtgatc       780
     gaaccggacg tcacgggcaa ggtgaccctg aaggtggaac aggtcccatg ggatcaggtt       840
     ctggacatga tcatatccat gaacgatctg ggacaggagc aggtcgggag cgtgattcgc       900
     atcgccaggc ggagcaagct caaaagcgaa tgggcccagc aggcggaagc catcagggcc       960
     aagcaggaat acctgttgac cagcaaggat ctgggagaga tcaatacggc atatcttacg      1020
     gtgaactacg cccaggtgac cgatgtcgcc agcaagatca acgaggcgaa gagcgataag      1080
     ggcaaggtat ccgtcgacga gcggacgagc ctgatcattt acagcgacta tccgggccgt      1140
     atcaacaacg ccaggatgct tctgaacagg cttgaccggc ccacttccca ggtgctcatc      1200
     gaagcccgca tcatcacgtt gacttcggaa gtcaaacggt ccctcggcat gaacctgggc      1260
     ttcggcggcg ataccccgaa tcattcggcg accgtgccgt tcacggattt tctgatcaac      1320
     agcccgccgg ccaatctgtt cgctctgaac cttgcgcaga tggtcggtac gacgctgctg      1380
     aaagtggacc tcactatttc ggccctcgaa accgccgacg agattcgcat catggcggct      1440
     ccgagagttc tgaccatgaa caacgtcaag gcagtgatct cccagggtgt gcaaattccc      1500
     tacctgaagg tcggcgatac ggcatccaac atcacgggca cggatttcaa ggacgccgtg      1560
     ctcgagctcg ccgtgacgcc gcatatcact cctgaccaca aggtgcggat gaccatcgag      1620
     gcaaaacagg acgaaccctc gagcaccgta accggagcgc aggggcagcc cggtatcgat      1680
     acgagaaaga tttccacgga actgctggtg gatgacggca acatcattgt gatcggcggc      1740
     atcatccgaa atcgggatga agccaagaag acggccacgc ccggactcag cgacgtcccc      1800
     attctgggca ggctgttcaa atcaaacgag gtcgatgcgc aaagaaacga aattttgatt      1860
     ttcatctgcc cgaaaattgt ggatgtgacg aaaccttctg atcgcacata g               1911
//

If you have problems or comments...

PBIL Back to PBIL home page