(data stored in ACNUC7421 zone)

EMBL: CP000478.PE538

CP000478.PE538       Location/Qualifiers
FT   CDS_pept        662072..662665
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sfum_0543"
FT                   /product="pyruvate ferredoxin oxidoreductase, gamma
FT                   subunit"
FT                   /EC_number="1.2.7.1"
FT                   /note="KEGG: pho:PH0678 pyruvate ferredoxin oxidoreductase,
FT                   gamma subunit; TIGRFAM: pyruvate/ketoisovalerate
FT                   oxidoreductase, gamma subunit; PFAM: pyruvate
FT                   ferredoxin/flavodoxin oxidoreductase"
FT                   /db_xref="EnsemblGenomes-Gn:Sfum_0543"
FT                   /db_xref="EnsemblGenomes-Tr:ABK16242"
FT                   /db_xref="GOA:A0LFP0"
FT                   /db_xref="InterPro:IPR002869"
FT                   /db_xref="InterPro:IPR011894"
FT                   /db_xref="InterPro:IPR019752"
FT                   /db_xref="UniProtKB/TrEMBL:A0LFP0"
FT                   /protein_id="ABK16242.1"
FT                   /translation="MTKKCIEMRWHGRGGQGAVTAAMIMAEAAYYEGYRGVTAAPFFGA
FT                   ERRGAPIIATTRFGREPIRTFSLVEQPDIVVVLDETLLRVVDVSAGVGPEGIVIINSAK
FT                   EPGAIRLKNAVNVATTNATEWAKEAGLIISGAVIFNTAILGGVARATGLISLESIEKAL
FT                   RNHFPGKAGERNVEGARAAYAGTSILQECKLACA"
     atgacgaaaa agtgcattga gatgagatgg cacggccgcg gcgggcaagg tgcggtcact        60
     gcggcgatga ttatggcgga agccgcctac tacgaggggt accggggggt cactgcggcc       120
     cctttcttcg gagcggaaag aagaggcgcc ccgatcatcg cgaccacccg gttcggaaga       180
     gagccgattc gcacgttctc actggtggaa caacctgaca tcgtggtcgt cctggacgag       240
     accctgctga gggtcgtgga cgtgagcgcg ggcgtgggcc ccgagggaat cgtgatcatc       300
     aacagcgcaa aagagcccgg tgcgatccgg ttgaagaatg cggtcaacgt cgcaacgacc       360
     aacgccacgg aatgggcgaa ggaggcgggc ctcatcatat cgggagcggt tatcttcaat       420
     accgcgatat tgggcggcgt ggccagggcc acggggctga tcagtctgga gagcatcgaa       480
     aaggcgttgc ggaatcactt cccgggaaag gccggcgaga gaaatgtcga gggtgcgcga       540
     gcggcctatg ccgggacctc gatcctgcag gaatgcaaac tggcttgtgc gtga             594
//

If you have problems or comments...

PBIL Back to PBIL home page