(data stored in ACNUC7421 zone)

EMBL: CP000478.PE540

CP000478.PE540       Location/Qualifiers
FT   CDS_pept        complement(663044..663607)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sfum_0545"
FT                   /product="protein of unknown function DUF208"
FT                   /note="PFAM: protein of unknown function DUF208; KEGG:
FT                   sat:SYN_02970 hypothetical cytosolic protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sfum_0545"
FT                   /db_xref="EnsemblGenomes-Tr:ABK16244"
FT                   /db_xref="GOA:A0LFP2"
FT                   /db_xref="InterPro:IPR003828"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="UniProtKB/TrEMBL:A0LFP2"
FT                   /protein_id="ABK16244.1"
FT                   /translation="MTTRRLLLHMCCGPCAIYPLRTLRADGWSVHGFFYNPNIQPCREF
FT                   ERRLEAARTVSEREELPLIVRDDYDPVEFLRNVVFREQQRCVYCYSVRIEAAARIARKS
FT                   GFDAFSTTLLYSKLQKHELIEEIARDTSRRIGVPFIYRDFRQGWREGHEAAKMMGIYRQ
FT                   QYCGCIYSEAERYHRGGKKDRPPK"
     atgacgacgc gccgcctgct gctgcatatg tgctgcggtc cttgcgccat ctatcctttg        60
     agaacgctca gagcggacgg ctggtccgtg cacgggttct tctacaatcc gaacatacaa       120
     ccctgccggg aattcgaacg cagactcgag gccgcgcgca cggtatcgga acgggaagag       180
     ctcccgctga tcgttcgtga cgattacgat ccggtggaat tcctgcggaa cgtcgtcttc       240
     cgcgagcagc agcggtgcgt ctactgctat tcggttcgaa tcgaggcggc ggcgcggatt       300
     gcccggaaaa gcggttttga cgccttctcc accaccctgc tctacagcaa gctccaaaaa       360
     catgaactga tcgaggaaat tgcgcgcgac acctcgcgga gaatcggagt ccccttcatc       420
     taccgggact ttcgtcaagg ctggagggaa ggtcacgaag cggcgaaaat gatgggcatc       480
     tatcggcagc agtattgcgg gtgtatctat tcggaggcgg agagatacca tcgcggaggg       540
     aagaaggacc gccccccgaa gtaa                                              564
//

If you have problems or comments...

PBIL Back to PBIL home page