(data stored in ACNUC7421 zone)

EMBL: CP000478.PE541

CP000478.PE541       Location/Qualifiers
FT   CDS_pept        complement(663604..665037)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sfum_0546"
FT                   /product="UDP-N-acetylmuramate--L-alanine ligase"
FT                   /EC_number="6.3.2.8"
FT                   /note="PFAM: cytoplasmic peptidoglycan synthetase domain
FT                   protein; cytoplasmic peptidoglycan synthetases domain
FT                   protein; Mur ligase, middle domain protein; KEGG:
FT                   dps:DP2930 probable
FT                   UDP-N-acetylmuramate:L-alanyl-gamma-D-glutamyl-meso-
FT                   diamino pimelate ligase"
FT                   /db_xref="EnsemblGenomes-Gn:Sfum_0546"
FT                   /db_xref="EnsemblGenomes-Tr:ABK16245"
FT                   /db_xref="GOA:A0LFP3"
FT                   /db_xref="InterPro:IPR000713"
FT                   /db_xref="InterPro:IPR004101"
FT                   /db_xref="InterPro:IPR013221"
FT                   /db_xref="InterPro:IPR036565"
FT                   /db_xref="InterPro:IPR036615"
FT                   /db_xref="UniProtKB/TrEMBL:A0LFP3"
FT                   /protein_id="ABK16245.1"
FT                   /translation="MRRKNSKTIYLLGIGGIAMGTLATMLTEKGFNVTGSDLNLYPPMS
FT                   THLETLGIPVCQGYDAANPEKCAPDLVIIGNAIRRTNPEAEYVLSHGLPYLSMPQAIAE
FT                   FFLCAHKSMVVAGTHGKSTTSSLLSWVLSRGGLDPSVFVGAFIKNWNSSYRIGRGPFMV
FT                   IEGDEYDTAFFDKGPKFLHYSPWIGIVTSVEFDHADIFTDFEAVRRAFRSFARLIQPDG
FT                   HLILNADDANCLALAKESRGRVTTYGWSRTADWRIVDMIHTDGRIRFTYENPLSRGTES
FT                   ILTRMPGRHNVSNSMAVMAAASLAGLDRNAVQDGLLTFEGVKRRQDILGEIGGILVMDD
FT                   FAHHPTAVRETIQALKDFYPRRRIFCAFEPRTNSSRRSVFQQAYTTAFDDAFCICIKHP
FT                   PGMDAIPREERLDVQKLVADIAERGKECHGFASAEDLIGFLVDHCASGDLVVCMSNGSF
FT                   DGLPHGLCTALAQKHAGAS"
     atgcgacgca agaattctaa gaccatctat ctgctcggca ttggcggaat cgccatgggc        60
     accctggcga caatgctgac ggaaaaaggc ttcaacgtca cggggtccga tctgaacctc       120
     tatcccccca tgagcactca cctggaaacg ctcgggatac cggtctgcca gggatacgac       180
     gccgccaatc cggagaagtg cgcgccggat ctcgtcatca tcggcaacgc catccggaga       240
     accaacccgg aagccgagta cgtgctgagc catggtctgc cgtacctttc gatgcctcag       300
     gccatagcgg aattcttcct gtgcgcccac aagagcatgg tcgttgccgg cacgcacggg       360
     aagagcacca cttcttccct gctgtcctgg gtgctgtccc ggggcgggct ggatccgagc       420
     gtttttgtgg gagcgttcat aaagaactgg aacagcagct accgtatcgg ccgcggccct       480
     ttcatggtca ttgaaggcga cgagtacgac acggcgtttt tcgacaaggg accgaaattc       540
     ctgcattact caccctggat cggcattgtg accagtgtcg agttcgatca cgcggacatc       600
     ttcacggatt tcgaggctgt ccgccgcgcc tttcgctctt tcgcgcgact catccaaccc       660
     gacggccacc tgatcctcaa cgccgacgac gcgaactgcc tggccctggc aaaagaatcc       720
     cgcggccgcg taaccaccta cgggtggtcc cggactgccg attggcgtat tgtcgatatg       780
     attcacaccg acggacggat tcgattcact tatgagaatc ccctgtcgcg gggaacggag       840
     tcgatactga cgcgcatgcc gggcaggcac aatgtgagca attccatggc cgtgatggcc       900
     gcggcctcgc ttgcgggtct cgacaggaac gcggtgcagg acgggttgct gactttcgaa       960
     ggcgtgaaac ggcgccagga catcctgggt gaaatcggcg ggattctggt catggacgac      1020
     ttcgcccatc accccacggc agtccgggaa accattcagg cattgaagga cttctatccc      1080
     cgaaggcgca ttttctgcgc cttcgaaccg aggaccaact cgagccggcg cagcgtattc      1140
     caacaggcct acacgactgc tttcgacgat gctttctgca tctgcatcaa gcatcccccc      1200
     ggcatggacg ccattccacg agaagaacgg ctggatgtcc agaaactggt tgccgatatc      1260
     gccgaacggg gaaaggagtg tcacggcttt gcatcggcag aagatctcat cggctttctg      1320
     gtcgaccact gcgcttcggg agatcttgtc gtgtgcatga gcaacgggag tttcgacgga      1380
     ctgccgcacg gactttgcac cgccctggcg caaaagcatg caggtgcatc atga            1434
//

If you have problems or comments...

PBIL Back to PBIL home page