(data stored in ACNUC7421 zone)

EMBL: CP000478.PE544

CP000478.PE544       Location/Qualifiers
FT   CDS_pept        complement(667040..667816)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sfum_0549"
FT                   /product="pantothenate kinase"
FT                   /EC_number="2.7.1.33"
FT                   /note="TIGRFAM: putative transcriptional activator, Baf
FT                   family; PFAM: Bordetella pertussis Bvg accessory factor;
FT                   KEGG: sat:SYN_02883 bvg accessory factor"
FT                   /db_xref="EnsemblGenomes-Gn:Sfum_0549"
FT                   /db_xref="EnsemblGenomes-Tr:ABK16248"
FT                   /db_xref="GOA:A0LFP6"
FT                   /db_xref="InterPro:IPR004619"
FT                   /db_xref="UniProtKB/Swiss-Prot:A0LFP6"
FT                   /protein_id="ABK16248.1"
FT                   /translation="MLLAMDIGNTNTVLGLFNEQRLVHDWRIRTEVNTTVDEYGIAIRS
FT                   LFDAHGFFVADVGSVIISCVVPPVLNSIERFCRKYFNIQPIIVGPGIRTGMPIFYDNPK
FT                   EVGADRIVNAVAAYDYYRCATIVVDFGTATTFDYISDKGEYMGGVISPGIMISCEALFF
FT                   KTSKLPRVEIFARPPSVLAKNTIASMNAGIVYGYAGLVEGIITRMRNEIGTNLKVVATG
FT                   GLAALIASECSLIDDVDDYLTLKGLRIIFERNKKNP"
     atgctcctgg caatggacat cgggaacacc aacacggtgc tcggcctttt caacgaacag        60
     cggctggtcc atgactggcg gatcagaacc gaggtgaaca ccacggtcga tgagtacggc       120
     attgcaatcc gcagcctgtt cgacgctcac ggttttttcg tcgcggacgt cggcagcgtg       180
     atcatctcct gtgtggttcc accggtcctc aattccatcg aacggttctg caggaagtat       240
     tttaacattc agccgatcat cgtcgggccg ggcatccgca cgggcatgcc cattttctac       300
     gacaacccga aggaggttgg cgccgaccgc atcgtcaatg ccgtggccgc ctatgactac       360
     taccggtgcg ccactatcgt ggtcgacttt gggaccgcca ccactttcga ctacatctcg       420
     gacaagggcg aatacatggg cggagtgatc agtcccggga tcatgatttc ctgtgaagcg       480
     ctcttcttca agacttcgaa gctgccaagg gtcgaaattt tcgccaggcc gccttcggta       540
     ctggccaaga acaccattgc gtccatgaat gcgggcattg tctacggcta cgcaggtctc       600
     gtggaaggca tcatcacccg gatgcgaaat gaaatcggga ccaatctgaa agtcgtcgcc       660
     acaggcgggc tggctgcgct gatcgccagt gaatgctcac tcatagacga cgtggatgat       720
     tatctgacgc tcaaggggct tcggatcatc ttcgaacgga acaagaagaa tccatga          777
//

If you have problems or comments...

PBIL Back to PBIL home page